KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1299Help
Entry
LRHK_1299         CDS       T01961                                 

Definition
viral (Super1) RNA helicase family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LRHK_1299
Enzymes [BR:lra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LRHK_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1239297..1241762
Genome map
AA seq 821 aa AA seqDB search
MDRHEDSVTGRVKSIFFQNPTNFFKILLIDITATTITWTEPDIVVTGTFGDIKEDETYTF
TGHVVDHPKYGQQFQADNYHVDRPTNKTGLINYLSSDKFPGIGPKTAEKIIDKLGVDAID
RILDDPESLKGLGISAAKQKMLVTNLKTNQGMERVIIGLNDYGFTSNMAGRIYQQYQNDA
LEVIKQNPYQLINDIDGIGFTRADQIAAKLAIAADSQLRLGGAVMDTLQRLTDGEGDTFV
DLKTLVTQTLDLLERARQVAVNPEAVGQAIVTLAKDNALVAEGKRIFPKRLYDSEWQIAR
QLKGLADAGRAAKQPALAEIKQTLAAVQEETGIAYDEVQKKAIITALQSPIFLLTGGPGT
GKTTVTDGIVRTYAQLHDLSLDRHEYTPDDPFPIMLAAPTGRAAKRISETTQLPASTIHR
LLGLGVDTQEFAPNDLPDGLLIIDEMSMVDTYLFRTLLTALHPGMQIVLVGDKDQLPSVG
PGQVFADLLRSQALPHAALTHIHRQDADSSIIPLAHAVNAGRLPDDFTRPQVDRSFLPCS
PSQVPEVVGQVVQRAAVKQFSIADIQVLAPMYRGTAGIDRLNPLLQDILNPKRSARTKTV
HFGETEYRIGDKILQLVNDPNQNVFNGEIGQIVGITLAKEAASKTDELTIDFDGNEITYK
RSDFSKITLAYATSIHKAQGSEFPMVILPLTMQSRRMLRRNLLYTAITRAKSFLILVGEL
AAFETAVGEIAVNRHTGLVQRLQQAFGMTVSQPDVEKPTPATEVSKNNGQIDTNPSDLDN
GISTDESNNYQLTPALVASQRIDPMIGMNGVTPQMFMTKEK
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacaggcatgaagatagcgtcactggccgggtcaaaagtattttctttcagaatccg
actaacttttttaaaatcctgctgattgatatcacggcaactacgattacctggacggag
ccggatattgtggtgaccggtacgttcggggatattaaagaagatgagacgtacacgttt
accgggcatgtcgtggaccatccgaaatatggccagcagtttcaagcggataattaccat
gtggatcggcctacgaataaaacgggactgatcaattatcttagttccgacaagtttccg
ggaattggccccaaaacagcggagaaaatcattgacaagctcggggttgatgcgattgat
cgtattttggatgaccctgagagcttaaaaggattggggatttcggcggccaagcagaag
atgctggtcaccaatctcaagacgaatcagggaatggaacgggtcatcatcggtcttaat
gactacggcttcaccagtaacatggctggccgaatttatcagcaatatcaaaatgatgcg
ctggaagtcattaagcaaaatccgtatcagttaatcaatgatattgacggtatcgggttt
acgcgggccgatcagattgccgccaagttagcgattgccgcggattcgcaactgcggctc
ggtggtgcggtcatggataccttgcagcgcttgacggacggtgaaggcgacacttttgtc
gatttgaaaacgttggtcacccagacgcttgatttactggagcgagcgcgtcaggttgca
gtgaaccccgaagcagtcggccaggcaatcgtcactttagccaaggacaatgcgctggta
gcggaaggtaagcgcatttttcctaaacgactttatgattccgaatggcagattgcccgg
cagttaaaaggactggcggatgccgggcgcgctgccaagcaacctgcactggccgaaatt
aaacaaacattggccgccgtacaggaagagactggcattgcctatgatgaggtgcaaaaa
aaggcgattatcactgccttgcagtcgccgatttttcttttaaccggcggccccggaacc
ggaaagacaacggtgacggacgggattgtccgcacctatgcgcaattgcatgatttatcc
ttggatcgccatgaatacacgccggatgatcctttcccgattatgctagcagcaccgact
ggccgggctgctaaacggatcagtgagacgacacagttaccggcaagcacgattcatcga
ctattgggattgggcgtggatacgcaggagtttgcgcctaatgatctcccggacggcctt
ttaattattgatgaaatgtcgatggttgatacgtatctttttcgaacgttgttgacggcg
ctgcacccgggtatgcaaattgtgttggttggcgataaagatcagctgccaagtgtcgga
ccgggacaggtttttgctgatttgttacgcagccaggctttacctcacgcagcgttaacc
cacattcaccgccaggacgcggacagttcgattatcccgttggcgcatgcagtcaatgcc
gggcgcttgccggatgacttcacccgcccgcaagtggatcggagctttttgccgtgttca
cccagccaggttccggaagtggtcgggcaggtggttcagcgtgccgcggttaaacagttt
tcgattgcggacattcaggtgcttgcaccaatgtatcgcggaactgcggggattgatcgg
ttgaatccattgttgcaggatattttgaacccgaaacgcagcgctcggacaaaaaccgtt
cattttggcgaaaccgagtatcgaattggcgataaaattctgcaattggtcaacgatccg
aatcaaaatgtgtttaatggcgaaattggccagattgtcgggatcacacttgccaaagag
gcggccagtaaaaccgatgagttgacgattgattttgacggcaatgaaataacgtataaa
cgcagcgacttcagcaaaatcaccttggcttatgcgacttcgattcacaaagcgcaaggc
agcgagtttccaatggtgattttgccattaaccatgcagagtcgccggatgctgcgccgg
aacctactttatacggccattacccgagcaaaatcgtttttgattctggtgggcgagctg
gctgcatttgagaccgcagttggcgaaattgcggtaaatcggcatacgggtttggtccag
cggctgcaacaagcgtttggcatgaccgtttcccagccggacgtagaaaagccgacgcct
gcaactgaagtcagcaagaataacggacaaattgacactaacccgtctgacttggataat
ggaattagtactgacgaatcgaacaattatcagctaacccctgcattggtggcttcacag
cggattgatcctatgattgggatgaatggtgtgacgccacaaatgtttatgacgaaggag
aaataa

DBGET integrated database retrieval system