KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1367Help
Entry
LRHK_1367         CDS       T01961                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00010  Glycolysis / Gluconeogenesis
lra00030  Pentose phosphate pathway
lra00051  Fructose and mannose metabolism
lra00052  Galactose metabolism
lra00680  Methane metabolism
lra01100  Metabolic pathways
lra01110  Biosynthesis of secondary metabolites
lra01120  Microbial metabolism in diverse environments
lra01130  Biosynthesis of antibiotics
lra01200  Carbon metabolism
lra01230  Biosynthesis of amino acids
lra03018  RNA degradation
Module
lra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_1367 (pfkA)
   00030 Pentose phosphate pathway
    LRHK_1367 (pfkA)
   00051 Fructose and mannose metabolism
    LRHK_1367 (pfkA)
   00052 Galactose metabolism
    LRHK_1367 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LRHK_1367 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LRHK_1367 (pfkA)
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LRHK_1367 (pfkA)
Protein phosphatases and associated proteins [BR:lra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LRHK_1367 (pfkA)
Messenger RNA biogenesis [BR:lra03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LRHK_1367 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AER64150
Position
1310242..1311201
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMSESTVGDK
IQRGGTMLYSARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTI
GLPGTIDNDIPYTDFTIGFDTAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWS
GVAGGAEDVIIPEHDFDVKKIASKLQSSRERGQKHAVILLAEGVMHADQFAKELAAYGDF
QLRATVLGHIVRGGAPSARDRVLASQMGAYAVELLLQGKGALAVGIENNKITAHDVRTLF
DAKHHAELSLYTLAEELTF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgaccagtggcggtgatgctccgggcatgaacgccgcggtt
cgagccgttgctcgcaaggcgatgcatgaaggccttgaagtatacggcatcaattatggc
tttgccggtttagtggccggtgacatttttaaaatgagcgagtcaacggttggtgacaag
atccaacgtggcggtaccatgctgtactccgcccgttatccgcagtttgctcaagaagaa
ggccaattgcgcggggttgaacagcttaacaagttcggcattgaagcactggttgttatt
ggcggcgatggttcataccacggtgcattggcactaacccgtcacggtttcaatacaatc
ggcttacccggcacgattgataatgatattccgtacactgatttcacgatcggatttgat
acggcggttaataccgtggttgaagcggtggatcggttgcgggatacggctgcatcccat
gaacggacctttgtcattgaggttatgggacgtgaagcaggtgacatcgcattgtggtct
ggcgttgccggcggggccgaagatgtcattatccccgaacacgacttcgatgttaaaaag
attgcttcgaagttacaaagttcccgtgaacgtggtcaaaagcatgcggttatcttgctg
gctgaaggcgtgatgcacgccgatcagtttgccaaggaacttgctgcctatggtgatttc
caattacgtgctaccgttttaggtcatatcgttcgtggtggtgcgccatcagcacgtgac
cgcgtattggcttcccaaatgggtgcttacgccgttgaactcttgctgcaaggcaagggt
gcgttggcagtcggcattgaaaataacaaaattacggcgcatgacgtccggactttgttt
gatgccaagcaccacgccgaactttcgctctacaccttggcggaagagttaacattttaa

DBGET integrated database retrieval system