KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1367Help
Entry
LRHK_1367         CDS       T01961                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LRHK_1367 (pfkA)
   01230 Biosynthesis of amino acids
    LRHK_1367 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_1367 (pfkA)
   00030 Pentose phosphate pathway
    LRHK_1367 (pfkA)
   00051 Fructose and mannose metabolism
    LRHK_1367 (pfkA)
   00052 Galactose metabolism
    LRHK_1367 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LRHK_1367 (pfkA)
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LRHK_1367 (pfkA)
Protein phosphatases and associated proteins [BR:lra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LRHK_1367 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1310242..1311201
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMSESTVGDK
IQRGGTMLYSARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTI
GLPGTIDNDIPYTDFTIGFDTAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWS
GVAGGAEDVIIPEHDFDVKKIASKLQSSRERGQKHAVILLAEGVMHADQFAKELAAYGDF
QLRATVLGHIVRGGAPSARDRVLASQMGAYAVELLLQGKGALAVGIENNKITAHDVRTLF
DAKHHAELSLYTLAEELTF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgaccagtggcggtgatgctccgggcatgaacgccgcggtt
cgagccgttgctcgcaaggcgatgcatgaaggccttgaagtatacggcatcaattatggc
tttgccggtttagtggccggtgacatttttaaaatgagcgagtcaacggttggtgacaag
atccaacgtggcggtaccatgctgtactccgcccgttatccgcagtttgctcaagaagaa
ggccaattgcgcggggttgaacagcttaacaagttcggcattgaagcactggttgttatt
ggcggcgatggttcataccacggtgcattggcactaacccgtcacggtttcaatacaatc
ggcttacccggcacgattgataatgatattccgtacactgatttcacgatcggatttgat
acggcggttaataccgtggttgaagcggtggatcggttgcgggatacggctgcatcccat
gaacggacctttgtcattgaggttatgggacgtgaagcaggtgacatcgcattgtggtct
ggcgttgccggcggggccgaagatgtcattatccccgaacacgacttcgatgttaaaaag
attgcttcgaagttacaaagttcccgtgaacgtggtcaaaagcatgcggttatcttgctg
gctgaaggcgtgatgcacgccgatcagtttgccaaggaacttgctgcctatggtgatttc
caattacgtgctaccgttttaggtcatatcgttcgtggtggtgcgccatcagcacgtgac
cgcgtattggcttcccaaatgggtgcttacgccgttgaactcttgctgcaaggcaagggt
gcgttggcagtcggcattgaaaataacaaaattacggcgcatgacgtccggactttgttt
gatgccaagcaccacgccgaactttcgctctacaccttggcggaagagttaacattttaa

DBGET integrated database retrieval system