KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_167Help
Entry
LRHK_167          CDS       T01961                                 

Gene name
pbg1
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_167 (pbg1)
Enzymes [BR:lra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LRHK_167 (pbg1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
173261..174697
Genome map
AA seq 478 aa AA seqDB search
MSAFPKDFLWGGAVAAHQFEGGWSADGKGISIADVMTAGDNQTKRRITDGVQPGENYPNH
DAIDFYHHYKDDVELFSELRLKCFRTSIAWSRIFPKGDEEQPNEKGLQFYDDLFDDLLAH
HIEPVITLSHFEMPYHLVQAYGGWRNRKLIGFFVKFAKVVFDRYKDKVKYWMTFNEINNQ
VGMLNEWSLFTNSGLIIQPDENKEQAMFQAAHYEAVASALAVQIGHMINPDFKIGCMVAM
GPVYPATPNPNDVFKAERMMQTNYYLADVQVKGHYPAFLEHYFARRQFNLDITLEDRDVL
LAGKVDYIGFSYYASHVVKAADDEPTDFITLGSNQEIKNTTLHRSDWGWEIDPVGLRYAL
NWFSDRYDVPLFIVENGLGAFDKVEENGSIHDDYRIDYLRQHIEQMKLAVEVDGVKLMGY
TPWGIIDLVSAGTGQMEKRYGVIYVDKDDQGKGTLARSKKDSFDWFHKVIQSNGEDLT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagcatttcctaaagattttttatggggcggcgctgttgctgctcatcaatttgag
ggcggatggtcagctgatggaaaaggaatcagtattgccgatgttatgaccgctggagat
aatcaaaccaaacgtcgaattacagatggcgttcaaccgggtgaaaactatccgaaccac
gatgccattgatttttatcaccactataaagatgatgtcgagcttttctcggaactgagg
cttaagtgtttccggacgagtattgcctggagccggatttttcctaaaggcgatgaagaa
caaccaaatgagaaaggcttgcagttttatgatgacttatttgatgatttgcttgcccat
catattgagcctgtgattacgttgtcgcattttgaaatgccttatcatttggttcaggct
tatggtggctggcgcaatcgtaaacttatcggcttttttgttaaattcgctaaggttgtc
tttgatcgctataaagataaagttaaatattggatgacctttaatgaaatcaataatcaa
gttgggatgcttaatgaatggtcgttatttacaaattcaggattgatcattcagccagac
gaaaacaaagagcaagctatgtttcaagcggctcattatgaggcagtagccagcgcacta
gctgtccaaatcgggcacatgattaaccccgactttaagattggctgcatggttgcaatg
gggccggtttatcccgcgactcctaatcccaacgatgtttttaaagctgaacgaatgatg
cagacaaattattatcttgcggatgttcaggtgaaaggacactatccggcctttttagaa
cactattttgcccgacgccaatttaatttggatattacattggaggatcgcgatgtccta
ctggctggtaaggttgattacattggtttttcgtattatgcatctcatgttgttaaagct
gctgatgatgaaccaactgatttcataacattgggatccaatcaggagattaaaaatacg
acattacaccgctcagattggggctgggaaattgatccggttggccttcgttatgcgctt
aactggttcagtgatcgctatgatgtaccgttattcatcgtggaaaatggcctgggcgcg
tttgataaagttgaagaaaacggcagtatccatgatgactatcgcattgactatttacgc
cagcatattgaacagatgaagttggctgttgaagttgatggggtcaagcttatggggtat
acaccttgggggattattgaccttgtatcagccggaaccggccagatggagaaacgatat
ggcgtcatttacgttgataaagacgatcagggaaaaggaacacttgccagaagtaagaag
gattcttttgactggttccataaggtcatccaaagcaatggtgaggatctcacctga

DBGET integrated database retrieval system