KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1675Help
Entry
LRHK_1675         CDS       T01961                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LRHK_1675 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_1675 (glcK)
   00052 Galactose metabolism
    LRHK_1675 (glcK)
   00500 Starch and sucrose metabolism
    LRHK_1675 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LRHK_1675 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LRHK_1675 (glcK)
   00524 Butirosin and neomycin biosynthesis
    LRHK_1675 (glcK)
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LRHK_1675 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1628309..1629271)
Genome map
AA seq 320 aa AA seqDB search
MNDQKLIGVDLGGTTVKFAILTQGGEIQQRWSIDTNILDEGSHILPDIVTSINEHLDLYK
MTPADFVGIGMGSPGSVDSEAGTIIGAYNLNWKTLQQARKVIESGTGIPFSVDNDANVAA
LGERWKGAGENDPDVTFVTLGTGVGGGIIANGELLHGVAGSGGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKETLDDGDEISSKIVFDLAKEGDRLALM
IVDRVSFYLGLALANVGNLLNPKFIVIGGGVSAAGEFLLTRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccaaaaattgattggcgtcgacttaggcgggacgaccgtaaaatttgccatt
ttaacgcagggtggcgagattcaacaaaggtggagtattgacaccaacattttggatgaa
ggcagccatattttaccggacattgttacatctattaacgaacatctggatttatacaag
atgaccccggctgattttgtcggcattggcatgggttcgcctggatcggtggacagtgag
gcgggcacaatcatcggtgcttacaacctaaattggaaaaccttgcagcaagccagaaaa
gtaatcgaatcagggaccggcattccgtttagcgtggataatgacgccaatgttgcggcg
ttaggtgagcgctggaaaggcgccggtgaaaacgatcctgatgtcacgtttgtcacgctg
ggtaccggtgttggcggcgggattattgccaatggcgagcttttgcacggtgttgccggt
tccggtggtgagctaggccatgtcaccgttgatccggttaatggctatctttgcacctgt
ggtaaacgcggttgccttgaaacagttgccagtgcgaccggcgtagttcgggttgcacgt
gacatggcagaagaatttgccggtgactctaagttaaaagaaaccttggacgatggcgat
gagatttcgagcaaaattgttttcgacttggccaaggaaggcgatcgtctggcgttgatg
attgtggatcgggtttctttttacctcggtttggctttggccaatgtcggcaatcttttg
aatccgaaattcatcgttatcggcggcggtgtctccgcggcgggtgaattcttgctgacg
cgagtcgacaagtatttcaaagaaaacaccttcccgaatgttcgtgaaaccaccagtttg
cggttggcgacacttgggaatacagctggcgttatcggtgccgcaagcttggcattgaag
taa

DBGET integrated database retrieval system