KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1815Help
Entry
LRHK_1815         CDS       T01961                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LRHK_1815 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    LRHK_1815 (thlA)
   00640 Propanoate metabolism
    LRHK_1815 (thlA)
   00650 Butanoate metabolism
    LRHK_1815 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    LRHK_1815 (thlA)
   00072 Synthesis and degradation of ketone bodies
    LRHK_1815 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LRHK_1815 (thlA)
   00310 Lysine degradation
    LRHK_1815 (thlA)
   00380 Tryptophan metabolism
    LRHK_1815 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LRHK_1815 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LRHK_1815 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LRHK_1815 (thlA)
Enzymes [BR:lra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LRHK_1815 (thlA)
Exosome [BR:lra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LRHK_1815 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1763477..1764658)
Genome map
AA seq 393 aa AA seqDB search
MEKVVILSAKRTPIGKLGGELAGASAVDLGVTAAKAAIKAARLDPQQLDQAIFGNVLQAG
SGQNVARQIALHSGMATNSTAMTINEVCGSGLKAIRLGQAAIQLGEANAVLVGGTESMSQ
VPYYAEAMRAGHKFGDTALVDGLSRDGLNDAFSQQPMGITAENVASRFQISRQAQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTISGRHGDVTIDTDSAIRPDTSLAQLAKLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITDYTEVGIDPDIMGYAPKLAIDQLM
QKTGQTLTAIDQVELNEAFASQSVAVMRDLGLTDEQVNINGGALALGHPLGASGARIMVS
LLYNLAERRQQTGIAALCVGGGIGMAMQVTLHD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgtgattcttagtgccaagcggacgccgattggaaagttgggcggtgag
ttagcaggtgctagtgcagtggatttaggtgttactgcagctaaggcggcgattaaagca
gcacggcttgatccgcaacaactggatcaagcaattttcgggaatgttttgcaggctgga
tcgggccagaatgttgcgcggcagattgcgttgcatagtggcatggcgacgaactccacg
gccatgacgatcaatgaagtttgcggctctgggctaaaggcaattcggttaggtcaggcg
gcgattcaactaggtgaagctaacgcggtacttgtcggcggtaccgagagtatgagtcag
gtaccgtattatgctgaggcaatgcgggccgggcataagtttggcgatactgcgttggtg
gatggtcttagtcgcgatgggctaaacgatgcttttagtcagcaaccgatggggattacg
gcggaaaatgttgccagccgctttcagatcagtcgtcaagcgcaagacgagtttgcactg
cgctctcatctgcgtgcggccgctgctgctgcagaaggccggtttaaatcacaaattgca
ccggtgaccatttccggccgacatggcgatgtcacgattgacacggattcggcgattcga
ccggatacatcattagcccagttagcaaaattaccgccagtttttgaagttggcggtacc
gtcacggcgggtaatgctagcgggattaatgacggggcggctgcattgattcttatggcg
aagtcaaaagccgagcagttaggcctccactatttggctaccatcactgactatacagaa
gtcgggattgacccggacatcatgggttatgcgcctaaattagcgattgaccagctaatg
caaaaaaccggacaaactttaacagccattgatcaagtggaattaaatgaagcattcgcc
tcgcaaagtgttgccgtgatgcgtgacttaggactgactgacgaacaggtgaatatcaat
ggcggagcgcttgctttaggccatcccttgggagcatccggcgcgcggattatggtttca
ttactgtataatctggccgaacgcaggcaacaaaccggtatcgcggcgttatgtgtcggt
ggtggtatcggtatggcgatgcaagttactttgcatgattag

DBGET integrated database retrieval system