KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2011Help
Entry
LRHK_2011         CDS       T01961                                 

Definition
guanylate kinase family protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lra00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1959542..1960144)
Genome map
AA seq 200 aa AA seqDB search
MKAAHKLIVITGATGTGKTTVSAYLRDNYRIHRVMTHTTRPPRTGEQNGVDYYFETPASF
ATKHFIEKVTYAGYEYGSSHESLEKNWAKHPFLSIVLDTKGAITYVRELPKEVVVLFLTI
DDPTVLKDRLLGRGDEPNMVAARLKSPEYKRDLTLPDELKPFATVIKNDRWDEARQQIDR
FMKDLALKSCGFLSVDTEQK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcgcataagttgattgtgatcacaggggcaacagggactggtaaaacaacg
gtgagcgcgtatctgcgcgacaactaccgaattcatcgggtgatgactcacacaacgcgg
ccaccgcggactggagaacaaaacggggttgattattattttgagacaccggcaagtttt
gcgactaagcattttattgaaaaagtcacttatgccggctatgaatatgggtcatcacat
gagtcgctggagaagaactgggctaagcatcccttcctaagcatcgttttggataccaaa
ggcgcgattacgtatgttcgtgagctgccaaaagaagtcgtcgttttgtttctgaccatt
gacgatcccacggttttgaaagatcgcctgcttggtcgaggagatgagccgaacatggtg
gcagcgcgattgaaaagccctgaatacaaacgcgacttaaccttgcctgatgaacttaaa
ccgtttgcgacagtcattaaaaatgatcgttgggatgaagcgcgacagcaaattgaccgg
ttcatgaaggacttggcgcttaaaagttgtggctttttgtcggtcgacaccgaacagaag
tga

DBGET integrated database retrieval system