KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2011Help
Entry
LRHK_2011         CDS       T01961                                 

Definition
(GenBank) guanylate kinase family protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00230  Purine metabolism
lra01100  Metabolic pathways
Module
lra_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LRHK_2011
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LRHK_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_28 T2SSE ABC_tran Thymidylate_kin AAA_23 ResIII CoaE AAA_16 AAA_30 AAA_33 AAA_25 Zeta_toxin AAA_26 DUF3391 PRK MMR_HSR1 DUF2075 SRP54 NTPase_1 AAA_14 AAA_19
Motif
Other DBs
NCBI-ProteinID: AER64762
Position
complement(1959542..1960144)
Genome map
AA seq 200 aa AA seqDB search
MKAAHKLIVITGATGTGKTTVSAYLRDNYRIHRVMTHTTRPPRTGEQNGVDYYFETPASF
ATKHFIEKVTYAGYEYGSSHESLEKNWAKHPFLSIVLDTKGAITYVRELPKEVVVLFLTI
DDPTVLKDRLLGRGDEPNMVAARLKSPEYKRDLTLPDELKPFATVIKNDRWDEARQQIDR
FMKDLALKSCGFLSVDTEQK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcgcataagttgattgtgatcacaggggcaacagggactggtaaaacaacg
gtgagcgcgtatctgcgcgacaactaccgaattcatcgggtgatgactcacacaacgcgg
ccaccgcggactggagaacaaaacggggttgattattattttgagacaccggcaagtttt
gcgactaagcattttattgaaaaagtcacttatgccggctatgaatatgggtcatcacat
gagtcgctggagaagaactgggctaagcatcccttcctaagcatcgttttggataccaaa
ggcgcgattacgtatgttcgtgagctgccaaaagaagtcgtcgttttgtttctgaccatt
gacgatcccacggttttgaaagatcgcctgcttggtcgaggagatgagccgaacatggtg
gcagcgcgattgaaaagccctgaatacaaacgcgacttaaccttgcctgatgaacttaaa
ccgtttgcgacagtcattaaaaatgatcgttgggatgaagcgcgacagcaaattgaccgg
ttcatgaaggacttggcgcttaaaagttgtggctttttgtcggtcgacaccgaacagaag
tga

DBGET integrated database retrieval system