KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2077Help
Entry
LRHK_2077         CDS       T01961                                 

Definition
melibiase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lra00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lra00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lra00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2025868..2028090
Genome map
AA seq 740 aa AA seqDB search
MANIEYDPQKQLFHLHNDTFSYIIQVIRGYLVKRYCGPALERFSGTAKLEDFSHAFNIQN
DAAPFSLTTLPLEYSTLMGGDYRTPAYAVRNGHGQLIGNLKFHDFQILAGNKNFNGTLPT
ARTPHGQTLVITMHDETDTLAVNLKYTIVGDLPVLLKQVAYHNLSDDTLTITHAASLQLD
FDDHAYDLITLTGAHLSEASVTRQPLTPGKKSIASNYGASGPQGVPATILAAPATDDFAG
EALGMALLWSGNFSYTAQVDQFGNSRLVMGLNPELFSWQLKPGEPFVTPEAAVAYTTNGL
NDLSHIFHRFFADHVMPLPRKNLIEYNTWESTYFDVSEAKVRAEIPKAEALGVELIVIDD
GWFKNRPNDAGQLGDWVPDPVKFPRGLRPIADALHERGLAFGLWVEPEMITENSELYAKH
PDWAMQYVGQKPLRSRNQLILDLSQRIVQDHLIKVLTDLVRTNHIDYLKWDYNRHFSQPG
SPVLPPDQQGEVGYRYTRGLYRVLKTLRDTFPDLLIENCSSGGGRLDGGMLAYTDQTWTS
DFTDPVYRMKIMNGFSLFFPLKTFVSHFTMSPNLQDSRVTPLQTRALLSLVGVTGIECPP
SQLSDAEAAAVKASFAFYKANRTELQNGSLYRLHPSHPNQDQVCWLITNEAKTKALVLTS
AGVVSPIPHYQHVLLHYLNPEVSYQTNDKATATGAELNYAGITLPLAHGDFSATLMTLRV
VSHLPQTTALPGGDIGELRF
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatagaatacgacccgcaaaagcagctctttcacctgcataatgatacgttt
agctacatcattcaggtgattcgcggctatttggtcaagcggtattgcggaccggcgctt
gaacgtttttccggtactgccaagctggaagatttcagtcacgcatttaacattcaaaat
gatgcggcgccgttttcgctcacgaccttgccgcttgaatatagtacgctgatgggcggg
gattatcgaacgcctgcgtatgccgttcgcaatgggcatggacaattgatcgggaatctg
aagtttcatgattttcagattctggcgggaaataaaaacttcaatggtactttgccgact
gcgcgcaccccgcatggccagacgctagtgatcacgatgcatgacgaaaccgatacgctg
gcggtgaatctcaagtacaccatcgttggcgatctgcctgtcctgcttaagcaagtggct
taccataatctgagtgacgacacccttacgattacccatgcagccagcttgcaactggac
tttgatgatcatgcctacgatctcattacgttgactggcgctcatctcagcgaagccagc
gtcacccggcaaccgctcacgccgggtaaaaagtccatcgccagcaattatggtgccagt
ggtccacaaggcgttccggcaacgattctggcggcaccggcaacggatgactttgcaggt
gaggcgcttggtatggcgctgttgtggagtggtaactttagctacaccgcgcaagtcgat
cagtttggcaacagtcggctggtgatgggcctgaatccggagctcttttcctggcagctg
aagcctggagaaccgtttgtgaccccggaagcggcggtggcttacacgaccaatggcttg
aatgatctcagtcatattttccaccgcttttttgccgatcacgtcatgccattgccgcgg
aaaaatctgatcgaatataacacttgggagtctacgtactttgatgtcagtgaagccaag
gtgcgcgccgaaattcctaaggccgaggcgctcggagtcgaattgattgtgattgatgat
ggctggttcaaaaatcggccgaatgatgccggtcagctcggcgattgggtccctgatccg
gtcaagtttccgcgcgggttgcggcccattgccgatgccttgcacgagcgcggattggca
ttcggcttatgggtcgaaccggaaatgatcactgaaaatagtgagttatatgccaagcat
ccagactgggcgatgcaatacgttggccaaaaaccgttacgttcgcgcaatcagttaatt
ctggatcttagccagcgaattgttcaggatcatctgattaaggtgctaaccgatttggtc
cggaccaatcatattgattatttgaaatgggattacaaccgtcatttcagccagcccgga
agtccggtactgccacctgatcaacaaggcgaagtcggctatcgttacacccgcggtttg
tatcgcgttttgaaaacgttgcgcgacacttttcccgatctgcttatcgaaaattgctcg
tcaggcggtggccggttagatggcgggatgctggcgtatacggatcaaacctggaccagt
gattttaccgaccccgtttaccggatgaaaattatgaacggcttctccttattcttcccc
cttaaaaccttcgtctcgcatttcacgatgtcaccaaatttgcaggactcgcgagtgacg
cctttgcaaacgcgggcgctgcttagtctggtgggcgttaccgggattgagtgtccgcca
agccagttgagtgacgctgaagcagcggcggttaaagccagctttgccttttacaaagct
aatcgtacggaattgcaaaatggcagtctttatcggctgcatcccagtcatccgaatcag
gatcaggtatgctggctgatcaccaacgaagccaaaaccaaggcgctcgtcttaacgtca
gctggcgtggtttcgccgattccgcactaccaacatgtgctgttgcattacctcaacccg
gaagtatcctaccagactaatgacaaggccacggccaccggtgctgaactcaattatgcc
gggatcactttaccgctggcgcatggtgatttttccgctaccttaatgaccttgcgcgtg
gtgagtcacctgccacaaaccacggcactgcctggtggcgacatcggtgagttgcgattt
tag

DBGET integrated database retrieval system