KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2190Help
Entry
LRHK_2190         CDS       T01961                                 

Gene name
bglH
Definition
aryl-phospho-beta-D-glucosidase BglH
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_2190 (bglH)
Enzymes [BR:lra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LRHK_2190 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2144194..2145642)
Genome map
AA seq 482 aa AA seqDB search
MNNLKFPKQFMWGGATAANQLEGAYHEDGKGLSIADVLPQGKDRFAIVNQPDFDWTIDES
KYRYPNHLGIDHYHHFKEDIKLFSEMGFKCYRFSIAWSRIFPEGDEQQPNQAGLAFYDAL
IAECLKYGIEPIVTISHYEMPLHLVTKYGGWKNKALITFYKRFAETVLTRYFKQVKYWMT
FNEINSAFSFPVMSQGLVASNGADDKRNIFQAWHNQFVASAWTVKIGHELDPQLQIGCML
LYATTYSYDANPVNQLATLQQNQAFNFFCGDVQVRGEYPAYTDAMMDEYGVKFQDLEFSA
AELALLKHYPVDYIGFSYYMSAVIETTQEHHAEVGGNLLSGLKNPFLKASEWGWQIDPIG
LRIALNQLYDRYRKPLFIVENGLGAIDRPDEKGEVQDDYRIDYLRQHIEQMGAAIHDGVD
LMGYTPWGCIDLVSASSGQMSKRYGFIYVDLDDDGEGTLARSKKKSFDWYRRVIASNGAD
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaataacttgaaatttccaaaacagtttatgtggggtggggcaaccgcggccaatcag
ctagaaggtgcttatcacgaggatggcaagggtttatcaattgccgacgtgttgcctcaa
ggaaaagaccggtttgcgattgtgaaccaaccggactttgactggacgattgatgaaagc
aagtatcgctatccgaatcatttgggcattgatcattaccaccattttaaagaagatatt
aagctatttagtgagatgggcttcaaatgttaccgcttttccattgcctggtcgcggatt
tttccagaaggtgatgagcagcaaccaaaccaagccggcttagctttttacgatgcgttg
attgcggagtgcttaaagtatggcatcgaaccgatcgtgacgatttctcattatgagatg
ccgcttcacttggtaaccaagtatggcgggtggaaaaataaagcgttgatcactttctac
aagcggtttgcggagactgtgttgacgcgatattttaaacaggttaagtattggatgacc
tttaacgaaattaatagtgcgttttcttttcctgtcatgagtcaaggcttggtcgccagt
aacggggctgatgataaacgcaacattttccaagcgtggcataatcagtttgtcgccagt
gcttggacagttaaaattggtcatgaattggatccgcagctgcaaatcgggtgcatgttg
ctgtatgcgaccacgtatagctatgatgccaatcctgtcaaccaacttgcaactttgcaa
cagaatcaggcgtttaactttttctgcggcgatgtgcaagtgcgcggtgaatatccggca
tacactgatgccatgatggatgagtacggcgttaagttccaggatcttgaattttccgca
gctgaattggcgctgttgaagcattacccggttgattatatcgggtttagctactacatg
tcagcggtgattgaaactacgcaggagcatcatgcagaagttggcggtaatttgctgagt
ggtctgaaaaatccgttcctgaaggcgagtgaatggggctggcaaattgatccaatcggt
ctgcgtattgccttaaaccaactttacgatcgttatcgcaagccactgttcattgttgaa
aatggtttaggcgccattgatcggcctgatgaaaagggtgaagttcaggatgattaccgg
attgattacttgcggcagcacatcgagcaaatgggtgcggcgattcatgatggcgttgat
ttgatgggttacacaccatggggctgcatcgacttggtgagtgcctcgtcgggacagatg
tcaaaacgctatggcttcatttacgttgatcttgatgatgatggggaagggacgttggcg
cgcagtaagaaaaagtcatttgattggtatcggcgcgtcattgcttcaaatggcgcggat
ctggcttaa

DBGET integrated database retrieval system