KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2260Help
Entry
LRHK_2260         CDS       T01961                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LRHK_2260 (recR)
DNA repair and recombination proteins [BR:lra03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LRHK_2260 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2209434..2210033)
Genome map
AA seq 199 aa AA seqDB search
MQYPEPISKLIDSYMRLPGIGAKTATRLAFYTIDMNKDDVTAFAKSLVAAKEDLHYCSIC
GNITDEDPCAICRDKNRDQSTILVVEQPKDVMSIDRAQDYHGLYHVLHGVLSPIEGRGPE
DLNIESLLKRLKKNTAVKEVIIATNATPEGEATAQYLARLIKPAGIKVTRLAHGLSVGSD
IEYADEMTLMKAVEGRTEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccggaaccgatcagtaagttaattgatagttatatgcgcttacccggcatt
ggcgctaaaacagctactagactggctttttataccattgatatgaacaaagacgatgtt
acggcatttgctaaaagtctggtcgcggctaaagaagatctgcattattgttcgatctgc
ggcaatattaccgatgaagatccgtgtgcaatttgtcgtgacaaaaatcgcgatcaaagc
accatcttggtcgtcgaacagcccaaagacgtcatgagtattgatcgggctcaagactac
catggcctttatcatgtgttgcatggggtgctatcgccaatcgagggtcgcggcccggaa
gaccttaacattgaaagccttttgaagcggctgaaaaagaataccgccgtcaaggaagtc
attattgcgaccaatgcaacgccagaaggggaagcaacagcccaataccttgcgcgcctt
atcaagccggctgggattaaagtgacgcgtttagctcatggcctttcggttggcagcgat
attgagtatgccgatgaaatgaccttaatgaaggcggttgaaggaaggactgagctgtaa

DBGET integrated database retrieval system