KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2332Help
Entry
LRHK_2332         CDS       T01961                                 

Gene name
gltX
Definition
glutamate--tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lra00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2284729..2286222)
Genome map
AA seq 497 aa AA seqDB search
MADRPIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTLVLRIEDTDTKRNVADGEKSQ
MDNLHWLGIDWDEGPDKGGDFGPYRQSERKDIYDKLIKQLVDKGFAYESYRTEEELKADR
EAQKARHEMPHYEYEYEGMSEAEKADAIAAAKAKGLQPVIRFHIPTDKTYEWNDIVKGKI
SIDANTLGGDFVIQKRDGMPTYNFAVVVDDHLMEISHVLRGDDHIANTPKQLAIYDAFGW
EPPIFGHMTLIINGATGKKLSKRDETVLQFIEQYRELGYLPDAMFNFITLLGWSPVGEDE
IFTKKEFIKQFDPKRLSKSPARFDQKKLEWVNNQYIKAKQKTNPNELMSLSLANLIEDGK
IQSDPDPKTIEWARQLISLYTDQMSYTAQISKLADIFFDKATDLTDDERKELADDNAKPV
IEAFAKKIRALDTFDAYSIGHIVNEVKQETQVKGRKLYMPIRIAATLRMHGPQLAETIEL
MGRDQVLKNVEIVTSQL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
ttggcagatcgaccaattcgggtgcgttatgcaccaagtccgactgggcatttgcatatt
ggcaatgcacggacggcgctgttcaattatttattcgcacggcacaacaaagggacgttg
gtgctgcggattgaagacaccgatacgaaacgcaacgttgcagacggtgaaaagagtcag
atggacaaccttcactggcttggtattgattgggatgaaggccctgataaaggtggcgac
tttggcccataccgtcagtctgaacgtaaagacatttatgacaagttgatcaagcagctt
gtggataagggctttgcttacgaatcatatcggaccgaagaggaactgaaagccgatcgc
gaagcccaaaaggcccgtcacgaaatgccacattacgagtacgaatatgaaggcatgagt
gaagcagaaaaggcggatgcaattgctgcagccaaggccaagggattacagccagtcatt
cggttccacattccgactgataaaacttatgagtggaacgatatcgttaaaggcaaaatt
tcaattgatgccaacacgcttggcggcgattttgtcattcaaaaacgtgatggcatgccg
acgtataactttgcggtggttgtcgatgaccatttgatggaaattagtcatgtgctgcgc
ggggatgaccacattgccaacacgccaaagcaattagcgatttatgatgcgttcggctgg
gaaccaccgatcttcggccatatgaccttgattatcaatggtgcaaccggtaagaagttg
tccaaacgcgatgaaacggttttgcaattcatcgaacaatatcgtgaattaggctacctg
ccagacgcaatgttcaactttatcaccctgttaggatggtctccggttggcgaagacgaa
atctttaccaagaaggaattcatcaagcagtttgatcctaagcgtttgtccaagagtccg
gcacggtttgatcaaaagaaactggaatgggtcaataaccagtacatcaaggctaagcaa
aagaccaatccaaatgagttaatgagcctgtcattggctaacctaattgaagatggcaag
attcaaagcgatccggatcccaagacgattgaatgggctcggcagctgattagcctttac
actgatcaaatgagttatacagctcagattagtaaattggcggatattttctttgataag
gccactgatttgactgatgatgagcgcaaggaactggcagatgataacgctaagccagtg
atcgaagcttttgccaaaaagattcgggcactcgacacgtttgatgcttattccattggg
cacatcgtcaacgaggtcaagcaggagacgcaagttaaaggacgcaagctttacatgcca
atccgaattgccgcaacattacggatgcatggcccacaactagccgaaaccatcgaatta
atgggacgcgatcaagtcttgaagaatgttgagattgtcacgtcacaactttaa

DBGET integrated database retrieval system