KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2355Help
Entry
LRHK_2355         CDS       T01961                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LRHK_2355
   01230 Biosynthesis of amino acids
    LRHK_2355
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_2355
  Energy metabolism
   00680 Methane metabolism
    LRHK_2355
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRHK_2355
Enzymes [BR:lra01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LRHK_2355
Exosome [BR:lra04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LRHK_2355
  Exosomal proteins of melanoma cells
   LRHK_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2312162..2312833)
Genome map
AA seq 223 aa AA seqDB search
MVKLVLLRHGESIANQQNTYTGWSDVGLTAQGKAQAAAAGKKIAATGILFEHVHTSVLSR
AIMTAYIVQDAIGQNYLPITKSWRLNERHYGALRGINKDLTRKLFGPDQVASWRRSFYAH
PPLLAHPSRSRRYHAYPATIIPRGESLADASERLLPYWSAELAPRLMAGKNQLIVAHGST
LRALVKYMEAISDAGINKVEIGNAQPIVYTLDQHLTILNKQTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaattagtccttttaagacatggcgaaagcattgctaatcaacaaaatacttat
actggctggtccgatgtcggattaacggcgcaagggaaagctcaagcagcagctgccggc
aaaaagattgcggcgaccgggatcttatttgagcatgtgcataccagcgtgttatcgcgg
gccattatgactgcctacatcgttcaggacgcaatcggccagaattacctgccgatcact
aaaagttggcgtctgaacgaacggcattatggcgccttacgcggaattaacaaagatctg
acccggaaactttttggcccggatcaagttgccagctggcggcgaagcttttatgcgcat
ccgccgttgttggcacatcccagtcgttcacggcgctatcacgcgtacccggcgacgatt
attccgcgcggtgaaagtcttgccgatgcgagtgagcgcctgttgccgtattggagtgcc
gaactggcgccgcggttgatggccggcaagaatcagcttatcgtggcgcacggctcaacg
ttacgggcattagtcaagtacatggaagctattagcgatgctggtattaacaaagttgaa
attggcaatgcccaacctatcgtctacacgcttgatcagcatttaaccattctcaataaa
caaacactgtga

DBGET integrated database retrieval system