KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_258Help
Entry
LRHK_258          CDS       T01961                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LRHK_258 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LRHK_258 (murE)
Enzymes [BR:lra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LRHK_258 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247502..249055
Genome map
AA seq 517 aa AA seqDB search
MALSLRACILLLKEHHLLKSAAIQTTEDVDMTGIAYDSRKVSGPTLFFCKGDKFRPIYLS
MAKDNGARTYVAEKPYVEGNGLNALIVRNITKAMAILSAAFFDYPQDDLFVIAYTGTKGK
TTAAYFTEAILNEARPRHIALFSTIDTVVGPEPDQRFKSNLTTPESLDLFRDMREAVENG
MTHLVMEVSSQAYLRNRVFGLTYDVGFFLNITPDHIGPNEHPTFANYLHNKLQLLVNARK
VVINAETEHFDQVYAAATTTTYPESIYLFASAGFKPKRDDIDIDFRFDSQEADVAESRFT
LVPVTEKAAALNIGGHYSLALIGDFNESNATAAIIGAGLAGVDASAAVPGIAKVKIPGRM
EHFQVPGHGTVYVDYAHNYASMKALLSFLKRSYKDPRLLVVVGSPGDKGVSRRPGFAKVL
TELATEAFLTTDDPGYEDPANIINEIDLKIDHTKVKVHKVLDRKEAITEAIKASGPKDVV
VVAGKGADPYQKIRGVNTPWPTDMAVVKEVTQSLQEG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcactatcacttagagcttgtattttattattgaaggaacatcacttattaaaaagt
gcggcaattcagaccactgaagatgtcgatatgaccggcattgcctatgattcacgaaaa
gtttccgggccgactttgtttttctgcaaaggggacaaatttcggccgatttatctgtcc
atggccaaagataacggcgccagaacctatgttgccgaaaagccttacgtggaaggtaat
ggtttaaatgccttaatcgttcggaatatcacaaaagcaatggcgattctcagtgcggcc
tttttcgattatccgcaagatgatttgtttgtaattgcttataccggtactaagggcaaa
acaaccgccgcttatttcaccgaggcgattttgaatgaggctcggccgcggcacatcgcc
ttgttctccaccattgatacagtggttggccctgagccggatcagcggtttaaatcgaac
ttaaccaccccggaaagtttggacttgttccgggatatgcgcgaagcagttgaaaatggt
atgacgcatttggtgatggaagtttccagtcaggcttatttacgtaatcgcgtctttggg
ctgacttatgatgtaggcttcttcttaaacattacccccgatcacatcggaccaaacgaa
catccgacttttgccaattatctgcacaataagctgcagttgttggtcaatgcgcgcaaa
gtagtgattaacgcggaaaccgagcattttgatcaggtctatgcggcagcaaccaccacg
acttatccggagagcatttatttgttcgccagcgctggattcaagcctaagcgcgacgac
attgatattgatttccgatttgacagccaagaagctgatgtcgccgaaagtcgctttaca
ctcgtgccggtaacggaaaaagcagcggcacttaatattggcggtcattattcgctggct
ttaatcggcgacttcaatgaaagtaatgcgacagcagcgattatcggcgccggcctggca
ggtgtggatgcatctgctgcggtgcctggcatcgccaaagtcaaaattccgggacggatg
gaacattttcaggttccgggccacggtacggtttatgtggattatgcccacaattatgct
agtatgaaggctttgttatcgttcctaaaacgttcctacaaagatccgcgcttgctggtc
gttgtcggctcccctggtgataaaggggtttcgcggcgcccgggctttgccaaagtatta
actgagttggcaacagaagcctttttaacaacagatgatcccggctatgaggatccagcc
aatattatcaatgaaatcgaccttaagattgatcacaccaaagttaaggttcacaaggtg
cttgatcgtaaagaagcgatcacggaagcgattaaggccagtggtcccaaagatgttgtg
gttgttgccggtaaaggcgcagatccgtatcaaaaaattcggggcgtcaacacaccttgg
ccgactgatatggccgttgtcaaggaagtcacccaatcgttacaggaaggctga

DBGET integrated database retrieval system