KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2627Help
Entry
LRHK_2627         CDS       T01961                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LRHK_2627 (asnB)
Enzymes [BR:lra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LRHK_2627 (asnB)
Peptidases [BR:lra01002]
 Cysteine Peptidases
  Family C44
   LRHK_2627 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2563290..2564879
Genome map
AA seq 529 aa AA seqDB search
MCGFLAVDSKEFDLTTFCDALEKNVDRGPDMTETVEEDAVMFGFNRLAIMDLSDDGMQPF
KGEDCTLVCNGEIYNFLQLKENVKDGFSFQSSSDCEVLIPLYRKYGLDTMCKMLDAEFAF
VLYDKVAKKVVAGRDPIGIRPMFYGYTKGKGEIAFGSTAKTLMDLCDQIFPFPPGHYYDG
EKFVTYRDPAMVTRMHTPSFEEATTGIRDYLVKGVEKRLHADAPVGYLLSGGLDSSLVCS
IASKLMPGKKLRTFAIGMDRNPIDLKYAREVADYLGTDHTEFIMTRDDVLGALRKVIYTL
ETWDITTIRASIGMYLLCKKIHETTDLKVILTGECSDEMFGYKYTDYAPNAEAFQSESMK
RVRELYMYDVLRADRCISANSLEGRVPFADLDFVEYVMSLDPDMKMNHYDKGKYLLRMAF
AGQDYLPDDILMREKAAFSDAVGHSLVDDLKEYADAKYTDEDVAKASEKYAYKTPFTKES
LLYRDIFEEFFPGKAEWIKDYWMPNSDWEGCDVDDPSARVLSNYGDSGK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggatttttagctgttgattctaaggaatttgatttaacgaccttttgcgacgcc
ctggagaaaaacgttgaccgcggcccggacatgaccgaaaccgttgaagaagacgcggtg
atgtttggtttcaaccgcctggcgatcatggacctgtccgatgacgggatgcaacccttc
aagggcgaagattgcaccctggtctgcaacggggaaatctataacttcttacagctcaag
gagaacgtaaaagacggcttcagcttccaaagctctagtgactgcgaagttttgatcccg
ctctaccgtaagtacgggctggacaccatgtgcaagatgctcgacgccgagttcgccttc
gtcttatacgacaaggtggccaagaaggtcgtggccggacgtgacccgatcgggatccgg
ccaatgttttacggctacaccaaggggaagggcgaaatcgcctttggttccacggccaag
accctgatggacttgtgcgaccaaatcttcccgttcccaccgggccactactacgacggc
gaaaagttcgttacctaccgcgacccggccatggttacccggatgcacacgccgagcttt
gaagaagccacgaccggcatccgtgattacctggtcaagggggtggaaaagcggctccac
gctgacgctccggtgggctatctgttgtccgggggcctggattcttccctggtttgctcg
atcgcatctaagttaatgccgggcaagaagttacggacctttgcgatcgggatggaccgc
aacccgatcgatctcaagtacgcccgcgaagttgccgactacttaggcactgaccacacc
gaattcatcatgactcgcgacgatgttctaggggcgctgcgtaaggttatttataccctg
gaaacctgggacattacgaccatccgggcctcgatcggaatgtacctattgtgcaagaag
atccacgaaacgacagacctgaaggtgatcctgaccggggaatgttccgacgaaatgttt
ggctacaagtacaccgactacgcgccaaacgccgaggccttccaaagcgaatcgatgaag
cgggttcgtgaactgtacatgtacgacgtgctgcgggccgaccgttgcatctcggctaac
tcccttgaaggccgggtgccgtttgccgacctcgacttcgtggaatacgtgatgtcctta
gacccggacatgaagatgaaccactacgacaagggtaagtacctgttgcggatggccttt
gccggacaagactacttgccagacgacatcttgatgcgggaaaaggcggccttctccgat
gccgttggtcactccctggtcgacgacttaaaggaatacgccgacgccaagtacacggat
gaagacgtggccaaggccagcgaaaagtacgcctacaagacgccatttaccaaggaatcc
ttgctctaccgcgacatctttgaagaattcttcccgggcaaggccgaatggatcaaggac
tactggatgccaaacagcgactgggaaggttgcgacgttgacgacccatccgctcgcgtt
ctctccaactacggggactcgggcaagtag

DBGET integrated database retrieval system