KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2680Help
Entry
LRHK_2680         CDS       T01961                                 

Gene name
ispE
Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LRHK_2680 (ispE)
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LRHK_2680 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2604581..2605459)
Genome map
AA seq 292 aa AA seqDB search
MELIEKAPAKINLSLDALYRHADGEHEWQMVMTSVDLADYVSIKPSHSIQVSTDSGFLPE
DPRNLAYKAALALQRHANIRQGARIHIEKHIPVAAGLGGGSSDAAAVLRGLNSLWQLGYS
RSQLARIGLQVDSDVPYCVYSETALVTGRGDVVTPLGSLPNFWVVLAKPRVSVSTPSILN
AIDYQAGLLHPNTPEVVAGVQNHDFNQMISGMGNSLEAITASRYPEMTALKQRLKKYGAE
IAQMSGSGPTVFGLCQKHSRAMRVYNSMKGFCREVYLLRPFCLSTNSHRLRG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaactgatcgagaaagcaccggccaagattaatctaagtttggatgctttgtatcgt
catgctgacggcgaacatgagtggcagatggtgatgacatcagttgatttggctgattac
gtgagcatcaagcctagccatagcattcaggtttccacagatagcggttttttacctgaa
gatccgcgaaatctggcctataaagcggcattggcgctccaacgccatgccaatatccgc
caaggtgcgcggattcatattgaaaaacacattcccgtcgctgcaggtttgggcggtggt
tcgagtgacgcagccgccgttttgcgtggcttgaattcactatggcagttaggttatagt
cgctcgcagctggctcgcatcggcttacaggttgatagcgatgtgccttactgcgtttac
tcggagacggccttggttaccggacgcggtgatgtggtcaccccattgggaagtttaccg
aacttttgggttgttttggctaagccgcgggtgtcagtgtcaacgccaagtattcttaat
gcaattgactatcaggccggccttttgcaccccaatacacctgaagtcgttgccggggtt
caaaaccatgatttcaaccaaatgattagcggaatggggaatagtttagaggccattacg
gcaagtcgttatcctgaaatgaccgcattgaaacagcggttaaaaaagtacggcgcagaa
atcgctcaaatgtcaggtagcggtccaactgtgtttggtctttgtcagaagcattctcgg
gcgatgcgggtttacaacagcatgaagggattttgtcgtgaggtttatctgttgcggcca
ttttgcctgtcaacgaatagtcatcggctaaggggttga

DBGET integrated database retrieval system