KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2762Help
Entry
LRHK_2762         CDS       T01961                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lra00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2679974..2681506)
Genome map
AA seq 510 aa AA seqDB search
MADSYIMAIDEGTTSTRAVILDHAGKMVGEAQKEFTQYFPKPGWVEHDANEIWEAVLSTI
ADTFISSGVQPRQIAGLGITNQRETTVIWDKTTGLPIYHAIVWQSRQTNALAEALRQAGH
GKMIHEKTGLLIDAYFSATKIRWILDHVPGAQERAENGELLFGTIDTWLSWKLSGGAIHV
TDYTNASRTMLFNIHTLDWDDEILQLLHIPRAMLPEVRSNSEIYGTGAAYHFFGSTVPIA
GMAGDQQSALFGQLALAPGMVKNTYGTGSFIVMNTGDKPKMSANNLLTTIAYGVNGQINY
ALEGSVFVAGSAIQWLRDQMGLVAQSPDTQQAAEAATSDDEVYVVPAFTGLGAPYWDAEA
RGAVFGLTRGTTKDDFIKATLQALAYQTRDVVDTMYKDTQIAVPALRVDGGAARNDYLMQ
FQADILNKPLERAANLETTAMGAAFLAGLAVGFWQDTDELKQIFKIGKRFEPRMTPARRE
NLYAGWQQAVAATQMFKHRPLPRTSTANNE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcagatagttacatcatggccattgatgaaggcacgaccagtacgcgcgcggttatt
ttggatcatgctggcaagatggtgggcgaggcgcaaaaggagtttacccagtattttcct
aaaccgggctgggtggagcacgatgcgaatgagatttgggaagcggtgttgtcgacgatt
gcggatacctttatttcgtctggggtgcagccgcggcaaattgcaggactcgggattacg
aatcagcgtgaaacaacggtgatttgggataagacaacggggctgccgatttatcatgcg
attgtgtggcagtcacggcagaccaatgcgttggcggaagcgttgcggcaggctggtcat
ggcaaaatgattcatgagaagaccggcttgctgattgacgcctatttttccgctacgaag
attcgctggattttggatcatgttccgggagcccaagagcgcgcggaaaatggcgagttg
ctgtttggcacgattgatacgtggctgagttggaagttatcaggcggcgcgattcatgtg
acggactacacgaatgccagtcgaacaatgttattcaacattcatacgttggattgggat
gacgagattttgcagttgctgcatattccgcgggccatgttgcctgaggtgcgcagtaat
tcggaaatttacggtactggcgcggcttatcatttcttcggcagcacggttccgattgca
gggatggccggtgaccagcaaagcgccttgtttggccagttagcgttggcgccggggatg
gtgaagaatacatatggtactggctcgtttattgtgatgaatacaggcgataagccgaaa
atgtctgctaataacttgttgacgacgattgcatatggcgtgaacgggcagattaattat
gctctggaaggctcggtgtttgtcgcgggctcggcgattcagtggctgcgcgatcaaatg
gggttggtggcgcaatcgcctgacacccagcaagcagccgaggcagccactagtgatgat
gaggtttatgtggtgcctgcgtttacaggcttaggggcaccgtattgggatgccgaagca
cgcggggcagtttttggcttgacccgcgggaccactaaagacgactttattaaagcgacg
ttgcaggctttggcttatcaaacgcgtgatgtggttgataccatgtacaaggacacgcag
attgccgtcccagccttacgcgttgacggtggggcagctcgcaatgattacctgatgcag
tttcaggcggatatcctgaataagcctttggaacgagccgccaatttagagacgaccgcc
atgggtgctgcctttttagcggggttggcagtcggcttctggcaggatacggatgaactt
aaacagattttcaagattggtaagcggtttgaacctcgcatgacaccggcgcggcgggag
aatttatacgccggttggcaacaggctgtcgccgccacgcagatgttcaagcaccggccg
ttaccacggacatccactgccaataacgaataa

DBGET integrated database retrieval system