KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2771Help
Entry
LRHK_2771         CDS       T01961                                 

Definition
class II Aldolase and Adducin N-terminal domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LRHK_2771
Enzymes [BR:lra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LRHK_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2689672..2690400)
Genome map
AA seq 242 aa AA seqDB search
MTEQYVFENERKDLAEVAREMFVRKNTNVAGGNISVRITADKDIDYGSIHIKAGKDYLIM
TPTMMSEAWYAKLQPTQILVVDLETGKQIDGVGRLTREINMHEEAYRANDKIRCVYHSHA
EESMFWATAGLDMPNVTEVTEEVGPIRVLPYAPACSKELADTVYNGLKAVGDAAKEHIFL
LNSHGVLITSEDLHHATEILETVEWNAKIAYQQTVFMKLGLLDSYQSCGKASDGMLKEQV
QA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagtatgtatttgaaaatgagcgtaaggatttggcagaagtagcgcgcgaa
atgtttgtgcgaaagaatacgaatgtcgctggtggcaatatcagcgttcgtattaccgcg
gataaagatattgattatggcagcattcatattaaggccggcaaagattatcttattatg
acacctaccatgatgtcagaagcttggtatgcgaagttacaaccgacccaaattctggtg
gttgatcttgagactggcaaacagattgatggggttggccgtttgacccgggaaatcaat
atgcatgaagaggcttatcgcgccaatgataagatccgttgcgtttaccattcacatgcc
gaagaatcaatgttttgggcaactgctggccttgatatgccaaatgttaccgaggtcact
gaagaagtcggaccgattcgcgtattaccctatgcaccggcttgctcaaaagaacttgcc
gacactgtctataatgggctcaaagcggtgggcgatgctgcaaaggaacacattttcttg
ttaaatagccacggcgttttgattacgtcggaagatttgcatcatgcaaccgagattctt
gagacggttgagtggaatgcaaaaattgcctatcagcaaacggtcttcatgaagctgggg
ctgctcgatagttatcagtcttgcggtaaagcgagtgatgggatgttgaaagaacaggta
caagcctga

DBGET integrated database retrieval system