KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_337Help
Entry
LRHK_337          CDS       T01961                                 

Definition
beta-galactosidase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LRHK_337
Enzymes [BR:lra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LRHK_337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331391..333172
Genome map
AA seq 593 aa AA seqDB search
MTTFSIDHEFMLDGKPFKILSGAIHYFRVHPSDWYHSLYNLKALGFNTVETYVPWNLHEY
REGEFDFSGILDIERFLKTAEDLGLYAIVRPSPYICAEWEFGGFPAWLLTKKMRLRTDDP
AYLAAIDRYYTALMPHLVDHQVTHGGNVIMMQVENEYGSYGEDQDYLAAVAKLMQQHGVD
VPLFTSDGPWPATLNAGSMIDAGILATGNFGSAADKNFDRLAAFHQEHGRDWPLMCMEFW
DGWFNRWGEPIIRRDPDETAEDLRAVIKRGSVNLYMFHGGTNFGFMNGTSARKDHDLPQV
TSYDYDAPLNEQGNPTPKYFAIQKMIHEELPEVQQAKPLVKPTMAPASHPLTAKVSLFAV
LDQLAKPIAASYPQTQEFLGQYTGYTLYRTQPLISGTDKGTPAKLRVIDARDRVQAYLDQ
KWLATQYQEAIGDDILLPEVEGHHQLDLLVENMSRVNYGSKIEAITQFKGIRTGVMVDLH
FIKGYQQYPLDLNRASRLTFTEGWQPATPAFYKYTFDLTAPQDTYLDCHGFGKGVMLVNG
VNVGRFWEKGPTLSLYVPAGLLHAGKNDVIVFETEGRYAESLKMADHPIFKEP
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccttttcgatcgatcatgaatttatgttggatgggaagccgttcaagatccta
tctggtgccattcattattttcgggtgcatccgagtgactggtatcacagcctgtataac
cttaaagctttagggtttaacacggtggaaacctatgtgccgtggaacttgcatgagtat
cgtgaaggcgagtttgattttagcggcatcctcgatattgaacgttttctcaaaactgcc
gaagatctcggcttgtatgcgattgtgcggccgtctccttatatctgtgcagagtgggag
tttggcggatttccggcatggctgttgacgaagaagatgcgtctgcgtaccgatgatcca
gcttatttggcggcaattgaccgttactataccgcattgatgccgcatttagttgatcat
caagttacccacggcggcaatgtgatcatgatgcaggtggaaaacgagtacggttcttat
ggtgaggatcaggattacttggcggcggttgcgaaactgatgcagcaacacggagttgat
gtgccactgttcacttcagatgggccgtggccagccaccttaaacgccgggagtatgatt
gatgccggcattctggcaacgggcaacttcggctcggctgccgataagaatttcgatcgg
ttagccgcttttcatcaggaacacggtcgcgactggccattgatgtgcatggaattctgg
gatggctggtttaaccgctggggtgagccgattatccgccgcgatcctgatgaaaccgcg
gaagatctgcgcgccgtcattaagcgcggcagtgtgaatctctacatgtttcatggtggg
acaaactttggcttcatgaacgggacgtctgcgcgtaaagaccatgacctgcctcaggta
acgtcttacgattacgatgccccgctaaatgaacaaggcaatccaacgccaaagtacttt
gccattcaaaaaatgatccatgaagagcttccagaagttcagcaagccaagccgctggtc
aaacccacgatggcgccagcttcacacccgttaacggctaaagtttccttgttcgcagtc
ttggatcagttagccaaaccgatcgccgcttcttatccgcagacgcaagaatttctgggc
caatataccggctataccttgtatcgtacgcagccgctcattagtggcactgacaaagga
acaccggccaagttgcgggtgatcgatgcccgtgatcgggtgcaagcttatttggatcaa
aaatggctagcaacccaataccaagaagcaattggtgatgatatcttgttgcctgaagtt
gagggacatcatcaacttgatttactggtagaaaacatgagtcgggtgaattacggatcc
aagattgaggcgatcacgcagttcaaagggattcgaaccggtgtcatggttgatctgcac
ttcatcaagggctatcagcaatacccgctggacttgaatcgcgcttctcggcttaccttt
acggaaggctggcagcccgcgaccccagcgttttacaagtacacgtttgatttgaccgcc
ccgcaagatacctatcttgattgtcatggattcggtaaaggagtgatgctggttaatggt
gtaaatgtcggcaggttttgggagaaaggccccacgttgtcactttatgtaccggcagga
ctcctgcacgccgggaaaaatgacgtcattgtgtttgaaaccgaaggccgctacgccgaa
agcttgaagatggctgaccacccgatatttaaggaaccatga

DBGET integrated database retrieval system