KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_53Help
Entry
LRHK_53           CDS       T01961                                 

Definition
O-Glycosyl hydrolase 30 family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LRHK_53
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LRHK_53
Enzymes [BR:lra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     LRHK_53
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(56471..58048)
Genome map
AA seq 525 aa AA seqDB search
MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPGDAAKIVIDPADRHQEWIGAGAA
ITDAAASLIWKQSKEQRSALLHEMFDPEEGHFSTIRIPLGSCEPASQPYYTYDDVPFGEH
DASLSKFSVGEGEPGAPDATKDLKYLIPVVQEILAINPAVKIMASPWSAPAWMKSTGELK
MGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLEEYRKYGIPIYAITIQNEPSNAAAWPA
MIWKIPELAHFGYKFLRPALDKTFPDTKIYFWDGSLNVLDVIDKPLSELVTPDEAAAFDG
FAFHTYDGPYTNLFKGSRLNPNWKLAMTERRCMIEETPEDASHIMFGLIGNWLVRQGLNM
IDLWNIALDERGLPNQVGSTGRRGVVTIDHTTGKVQRNLEYYMLRNFNQDVVPGSIVIGS
TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNPSGKPLDAAVTINNDGPVTWQHVTVPAWGT
VTLHKAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaactgaaaaaggcttatacccgacggaattttggacggtaacggctggcgat
ctggcacaaaagcgtgaccatctggcaactccaaaaccagaaacgacacccggcgatgca
gccaagatcgtgattgatcctgctgaccggcatcaggaatggatcggcgcaggtgccgcc
atcaccgatgcagcagcatcacttatctggaagcagagcaaggaacaacgcagtgccttg
ctacatgaaatgtttgacccagaagaaggtcatttctcgaccatccgtattccattagga
tcctgcgaaccagccagtcaaccttattacacttatgatgatgtgccatttggcgagcat
gatgcatccttatctaagttttctgttggtgaaggtgaacccggagcgcctgatgcaacc
aaagatcttaaatatctgattccggttgttcaggaaattctggcgattaacccagccgtt
aagattatggcttcaccatggtctgctcccgcttggatgaagagtaccggcgaactaaaa
atgggcggccacttacgttttggcgaatataccaacaatggctatgcaattaaggacacg
ttcgaaggcgtttacgcgcaatactttgttcgttaccttgaagaatatcgcaagtatggc
attccgatttacgccatcacgatccaaaacgaaccttccaatgcagctgcatggccagcc
atgatctggaagattccggaactggcacactttggctacaagttccttcgcccggctttg
gacaagaccttccctgataccaagatttacttctgggatggcagtttaaacgtccttgat
gtcatcgacaagccactaagcgagttggtgacccctgatgaagcggctgcatttgatggt
tttgccttccatacctacgatggtccttacaccaacttgtttaaaggcagtcgcctgaat
ccaaactggaaactcgccatgaccgaacgccgctgcatgatcgaagaaacaccagaagat
gcttctcatattatgtttggcttgatcggtaattggctcgtgcgtcaaggcttgaacatg
attgatctttggaacattgccttggacgaacggggcttgccaaaccaggtagggtcaact
ggccgtcgcggggttgtcaccattgatcacacaaccggtaaagttcaacgtaacctggaa
tactacatgctgcgtaacttcaaccaagatgttgttccgggatctattgtgattggctcc
accaactacacgcaagatggctacaccggtggcttaggctccgttgcctttcttgctccc
gatggcgccattgctgctcacctctacaacccatccggcaagccgttggacgccgccgtt
accatcaacaatgacggcccggttacttggcagcatgttaccgttccggcatggggaacc
gtaacgcttcataaggcatttggtcccgtcaatgaaagtgcgccgcgtcaggatgaagac
ttcaagctgaatccttatccggcaaatctgatggacgactgggcaccgggcaaaggtgtg
aatgctaacaagaaataa

DBGET integrated database retrieval system