KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_53Help
Entry
LRHK_53           CDS       T01961                                 

Definition
O-Glycosyl hydrolase 30 family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lra00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lra00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(56471..58048)
Genome map
AA seq 525 aa AA seqDB search
MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPGDAAKIVIDPADRHQEWIGAGAA
ITDAAASLIWKQSKEQRSALLHEMFDPEEGHFSTIRIPLGSCEPASQPYYTYDDVPFGEH
DASLSKFSVGEGEPGAPDATKDLKYLIPVVQEILAINPAVKIMASPWSAPAWMKSTGELK
MGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLEEYRKYGIPIYAITIQNEPSNAAAWPA
MIWKIPELAHFGYKFLRPALDKTFPDTKIYFWDGSLNVLDVIDKPLSELVTPDEAAAFDG
FAFHTYDGPYTNLFKGSRLNPNWKLAMTERRCMIEETPEDASHIMFGLIGNWLVRQGLNM
IDLWNIALDERGLPNQVGSTGRRGVVTIDHTTGKVQRNLEYYMLRNFNQDVVPGSIVIGS
TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNPSGKPLDAAVTINNDGPVTWQHVTVPAWGT
VTLHKAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaactgaaaaaggcttatacccgacggaattttggacggtaacggctggcgat
ctggcacaaaagcgtgaccatctggcaactccaaaaccagaaacgacacccggcgatgca
gccaagatcgtgattgatcctgctgaccggcatcaggaatggatcggcgcaggtgccgcc
atcaccgatgcagcagcatcacttatctggaagcagagcaaggaacaacgcagtgccttg
ctacatgaaatgtttgacccagaagaaggtcatttctcgaccatccgtattccattagga
tcctgcgaaccagccagtcaaccttattacacttatgatgatgtgccatttggcgagcat
gatgcatccttatctaagttttctgttggtgaaggtgaacccggagcgcctgatgcaacc
aaagatcttaaatatctgattccggttgttcaggaaattctggcgattaacccagccgtt
aagattatggcttcaccatggtctgctcccgcttggatgaagagtaccggcgaactaaaa
atgggcggccacttacgttttggcgaatataccaacaatggctatgcaattaaggacacg
ttcgaaggcgtttacgcgcaatactttgttcgttaccttgaagaatatcgcaagtatggc
attccgatttacgccatcacgatccaaaacgaaccttccaatgcagctgcatggccagcc
atgatctggaagattccggaactggcacactttggctacaagttccttcgcccggctttg
gacaagaccttccctgataccaagatttacttctgggatggcagtttaaacgtccttgat
gtcatcgacaagccactaagcgagttggtgacccctgatgaagcggctgcatttgatggt
tttgccttccatacctacgatggtccttacaccaacttgtttaaaggcagtcgcctgaat
ccaaactggaaactcgccatgaccgaacgccgctgcatgatcgaagaaacaccagaagat
gcttctcatattatgtttggcttgatcggtaattggctcgtgcgtcaaggcttgaacatg
attgatctttggaacattgccttggacgaacggggcttgccaaaccaggtagggtcaact
ggccgtcgcggggttgtcaccattgatcacacaaccggtaaagttcaacgtaacctggaa
tactacatgctgcgtaacttcaaccaagatgttgttccgggatctattgtgattggctcc
accaactacacgcaagatggctacaccggtggcttaggctccgttgcctttcttgctccc
gatggcgccattgctgctcacctctacaacccatccggcaagccgttggacgccgccgtt
accatcaacaatgacggcccggttacttggcagcatgttaccgttccggcatggggaacc
gtaacgcttcataaggcatttggtcccgtcaatgaaagtgcgccgcgtcaggatgaagac
ttcaagctgaatccttatccggcaaatctgatggacgactgggcaccgggcaaaggtgtg
aatgctaacaagaaataa

DBGET integrated database retrieval system