KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_748Help
Entry
LRHK_748          CDS       T01961                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LRHK_748 (ruvA)
Enzymes [BR:lra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LRHK_748 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
739318..739914
Genome map
AA seq 198 aa AA seqDB search
MYEYFEGTIQAVTPAYIVIDVNGIGFRLLVANPYDFEAGKQTRIYVQLIIRENDQTLYGF
ETAADKRTFNQLLSVTGIGPKSALAILANVSSGGLATAIAQDDVKFLTKFPGIGKKTAAQ
IILDLKGKITTDAQPAAATIMPTADQVAPELADALAALVALGYTQRAVDGITDALKAFDA
TTTDAYLREGLRLLSGRA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatactttgaaggcacaattcaggccgtaacgccggcgtacattgtcattgat
gtcaatggcatcggatttcgcctgctggtagccaatccatacgattttgaagcgggaaag
cagacccggatttatgtgcaactcatcatccgcgaaaatgatcaaacactttacggattt
gaaacggcagcggataaacgaacttttaaccagttgttatccgtcaccggcattggtccg
aaatcagcgttggcaattttggcaaatgtttcaagtggtggcctagcaactgccattgcc
caagatgatgttaaatttttgaccaagtttccgggcatcggtaagaagacggccgctcag
attatcctggatctaaaaggcaaaattacgaccgatgctcaaccggctgccgcaacgatc
atgccgaccgccgatcaagtagcgccggagctggcagatgccttggctgcactggttgcc
ttaggatacacccaacgcgcggttgatggcattaccgatgctttgaaagcctttgacgcc
acgacgaccgatgcttatctgcgtgaaggtttacgcttgttgagcggacgagcataa

DBGET integrated database retrieval system