KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_92Help
Entry
LRHK_92           CDS       T01961                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lra01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lra00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lra00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96293..97513)
Genome map
AA seq 406 aa AA seqDB search
MKTLNETAQPTNRAGRYGNDFGGQYIPETLMTELEKITAAFNTLKDDPQFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKIRLIAET
GAGQHGVATATIAALMGMECEIFMGKEDTDRQKLNVYRMTLLGAKVHSVTSGSMVLKDAV
NAALQEWASRSDDTFYVLGSAVGPAPFPEMVKHFQSVISIESKQQLQAKAGQLPDMIVAC
VGGGSNAIGSFAAYIDEPSVQLVGVEAAGKGVDTARTAATIERGSVGIFHGMKSLFMQNE
DGQIDPVYSISAGLDYPGVGPEHAALAEAGRAQYVGITDDEAVQAFEYIARQEGIVAAIE
SCHAIAYVEKIAPTMAKDQIIICTLSGRGDKDVASIAKYKGVDVDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactaaatgaaactgctcaacctacaaaccgcgccggccgctatggcaacgac
tttggcggccagtatatcccggaaaccttaatgaccgaactcgaaaaaatcaccgcggct
ttcaacactttaaaagacgacccgcaattcaaagccgaactcaacgatttgttagtcaat
tatgctaaccgaccatcgctactgtattacgccaaaaacatgaccgaagacttaggcggg
gccaagatctatctcaaacgtgaggatctcaatcatactggtgcccataaaatcaacaat
gttatcggacaagccttactcgccaagcatctaggcaaaatccggttaattgccgaaacc
ggcgctggccaacacggtgttgccaccgcaacgattgccgctttgatgggcatggaatgt
gaaattttcatgggaaaagaagacactgaccgccaaaagttaaatgtttatcgcatgacc
ttgctcggcgccaaagtccattctgtcaccagcggctcgatggtgcttaaagacgcggtc
aacgctgcccttcaggaatgggccagtcgcagcgatgacaccttttatgtgcttggttca
gccgtgggtccagcaccatttccggagatggtcaaacattttcaaagcgtcatttccatt
gaatccaagcaacaactgcaggctaaagcaggacagctgccggacatgatcgtagcctgt
gtcggcggcggcagtaacgccattggcagttttgccgcatacattgatgagccttctgta
caactggtcggcgttgaagccgctggcaaaggtgttgatacggcgcgaaccgctgctacg
atcgaacgcggcagtgtcggtattttccacggcatgaaatccttattcatgcaaaacgaa
gatggacaaatcgatccggtttactccatctctgctggtcttgactaccccggcgttggc
ccggaacacgccgccctcgccgaagcaggccgtgcccaatatgttgggatcaccgatgac
gaagcagttcaggcatttgaatacatcgcgagacaagaaggcattgtcgcggcgatcgaa
agctgccacgccattgcttacgttgaaaaaattgccccaaccatggccaaggaccaaatc
atcatctgcaccttatccggccgcggcgataaagatgttgctagcattgccaaatacaaa
ggagttgacgttgatgagtaa

DBGET integrated database retrieval system