KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_973Help
Entry
LRHK_973          CDS       T01961                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00010  Glycolysis / Gluconeogenesis
lra00051  Fructose and mannose metabolism
lra00562  Inositol phosphate metabolism
lra01100  Metabolic pathways
lra01110  Biosynthesis of secondary metabolites
lra01120  Microbial metabolism in diverse environments
lra01130  Biosynthesis of antibiotics
lra01200  Carbon metabolism
lra01230  Biosynthesis of amino acids
Module
lra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lra_M00002  Glycolysis, core module involving three-carbon compounds
lra_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_973 (tpiA)
   00051 Fructose and mannose metabolism
    LRHK_973 (tpiA)
   00562 Inositol phosphate metabolism
    LRHK_973 (tpiA)
Enzymes [BR:lra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LRHK_973 (tpiA)
Exosome [BR:lra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LRHK_973 (tpiA)
  Exosomal proteins of bladder cancer cells
   LRHK_973 (tpiA)
  Exosomal proteins of melanoma cells
   LRHK_973 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AER63762
Position
924345..925100
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQAFLDAVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMGVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
DSFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaccattcattgctggtaactggaaaatgaacaagaaccctaaggagacgcaa
gccttcttagatgctgttaaaggtaagttacctgatgcaagcaaagttgaaacagtcatt
ggcgcacctgccattgatctaacgacgctggttgccggtgcagaaggcactcctttgaag
acagcggcggaaaactgctactttgaagacgaaggtgcttttaccggcgaaaccagcccg
aaagccttaaaagaaatgggcgttgattacgtcattatcggtcacagtgaacgtcgtggt
tatttccacgaaaccgacgaagatatcaacaagaaggctaaggccatctttaagaacaat
cttttgccgattatctgctgtggtgaaagtttggctcagcgtgaagccggtcaaaccgaa
gattgggttgcttctcaaatcgaagcagctttggcaggcttaagtgccgaccaagttaag
gtttcggttttggcttacgaaccaatctgggctatcggcactggtaaaacagcaactgca
gatcaagcacaagaagttgttgctcacatccgtgcaaccgttgagaagttgtataataaa
gatacggcagatgctgttcggattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatattgatggtggcttagttggtggcgcttcgatggatcct
gacagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system