KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_980Help
Entry
LRHK_980          CDS       T01961                                 

Definition
esterase D
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Brite
Enzymes [BR:lra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LRHK_980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
929955..930689
Genome map
AA seq 244 aa AA seqDB search
MIFRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRAGYGVYVPLFSGHGTVEPLD
ILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPI
LPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPT
FIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQ
ENEG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgattttccgcaaaccacaaccattcgaatatgaaggtaccgatactggcgtggtattg
ttacatgcatacacgggtagccccaatgatatgaattttatggcgcgggccttgcagcga
gccggttatggggtttatgttccgcttttttccgggcatgggacagtggagccgttagac
attttgacaaaaggcaacccggatatttggtgggcagaaagtagtgccgcggttgcgcat
atgacggcaaaatacgccaaggtgtttgtttttggcttatcactgggaggtattttcgcg
atgaaggcgctagaaaccttgccagggattacagcaggcggtgttttttcatccccgatt
ttgccgggcaaacatcacttagtaccgggttttttaaagtatgccgagtatatgaatcgg
ttagcaggcaaatcagatgaaagcacacagattctggcatatttgccgggacagttggcc
gcaatcgatcagtttgccacgacggttgctgctgatttaaatttagtcaaacagccgact
tttattggacaagccggtcaggatgaattagttgatggtcgattagcgtatcaattacgc
gatgccttaatcaatgctgcacgcgttgattttcattggtatgatgatgccaagcatgtc
attaccgttaactcggcccatcacgcattagaagaagacgtaatcgcatttatgcaacaa
gaaaacgagggatag

DBGET integrated database retrieval system