KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_0052Help
Entry
LOCK908_0052      CDS       T02731                                 

Definition
Hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LOCK908_0052
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LOCK908_0052
Enzymes [BR:lrc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     LOCK908_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(61050..62627)
Genome map
AA seq 525 aa AA seqDB search
MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPGDAAKIVIDPADRHQEWIGAGAA
ITDAAASLIWKQSKEQRSALLHEMFDPEEGHFSTIRIPLGSCEPASQPYYTYDDVPFGEH
DASLSKFSVGEGEPGAPDATKDLKYLIPVVQEILAINPAVKIMASPWSAPAWMKSTGELK
MGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLEEYRKYGIPIYAITIQNEPSNAAAWPA
MIWKIPELAHFGYKFLRPALDKTFPDTKIYFWDGSLNVLDVIDKPLSELVTPDEAAAFDG
FAFHTYDGPYTNLFKGSRLNPNWKLAMTERRCMIEETPEDASHIMFGLIGNWLVRQGLNM
IDLWNIALDERGLPNQVGSTGRRGVVTIDHTTGKVQRNLEYYMLRNFNQDVVPGSIVIGS
TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNPSGKPLDAAVTINNDGPVTWQHVTVPAWGT
VTLHKAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaactgaaaaaggcttatacccgacggaattttggacggtaacggctggcgat
ctggcacaaaagcgtgaccatctggcaactccaaaaccagaaacgacacccggcgatgca
gccaagatcgtgattgatcctgctgaccggcatcaggaatggatcggcgcaggtgccgcc
atcaccgatgcagcagcatcacttatctggaagcagagcaaggaacaacgcagtgccttg
ctacatgaaatgtttgacccagaagaaggtcatttctcgaccatccgtattccattagga
tcctgcgaaccagccagtcaaccttattacacttatgatgatgtgccatttggcgagcat
gatgcatccttatctaagttttctgttggtgaaggtgaacccggagcgcctgatgcaacc
aaagatcttaaatatctgattccggttgttcaggaaattctggcgattaacccagccgtt
aagattatggcttcaccatggtctgctcccgcttggatgaagagtaccggcgaactaaaa
atgggcggccacttacgttttggcgaatataccaacaatggctatgcaattaaggacacg
ttcgaaggcgtttacgcgcaatactttgttcgttaccttgaagaatatcgcaagtatggc
attccgatttacgccatcacgatccaaaacgaaccttccaatgcagctgcatggccagcc
atgatctggaagattccggaactggcacactttggctacaagttccttcgcccggctttg
gacaagaccttccctgataccaagatttacttctgggatggcagtttaaacgtccttgat
gtcatcgacaagccactaagcgagttggtgacccctgatgaagcggctgcatttgatggt
tttgccttccatacctacgatggtccttacaccaacttgtttaaaggcagtcgcctgaat
ccaaactggaaactcgccatgaccgaacgccgctgcatgatcgaagaaacaccagaagat
gcttctcatattatgtttggcttgatcggtaattggctcgtgcgtcaaggcttgaacatg
attgatctttggaacattgccttggacgaacggggcttgccaaaccaggtagggtcaact
ggccgtcgcggggttgtcaccattgatcacacaaccggtaaagttcaacgtaacctggaa
tactacatgctgcgtaacttcaaccaagatgttgttccgggatctattgtgattggctcc
accaactacacgcaagatggctacaccggtggcttaggctccgttgcctttcttgctccc
gatggcgccattgctgctcacctctacaacccatccggcaagccgttggacgccgccgtt
accatcaacaatgacggcccggttacttggcagcatgttaccgttccggcatggggaacc
gtaacgcttcataaggcatttggtcccgtcaatgaaagtgcgccgcgtcaggatgaagac
ttcaagctgaatccttatccggcaaatctgatggacgactgggcaccgggcaaaggtgtg
aatgctaacaagaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system