KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_0375Help
Entry
LOCK908_0375      CDS       T02731                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lrc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LOCK908_0375
Enzymes [BR:lrc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LOCK908_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379884..380825
Genome map
AA seq 313 aa AA seqDB search
MPNHVVVIGSINVDAILHIQRLPQPGETIQMDAFSKAAGGKGANQAVAAARSGAKTSFIG
RVGNDANAAFMRGELVKNQIDTQYVATTADTETGQAYILLQASGQNSIIIQHGANFELTP
ADVQRATGLIQSADFVVAELETPVAATAEAFKIAKAADKVTILNPAPAQKDLPEALLKNV
DLIAPNETESELITGIPVTDEASMRQSAAYYHQLGIRGVVITLGSKGSFISLNGQATLVP
AFKVKAVDTTAAGDTFIGALVSNLQPDLGNIVDAATYASMASSFTVQKLGAFPSIPMGDE
VRAGLAKVKMGPA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcatgttgtcgttattggcagtatcaatgtggatgctatcttgcacattcaa
cgactgccacagccgggggaaacaattcaaatggatgctttttctaaagctgccggtggt
aagggggccaatcaagcggttgcggcggcgcgatctggcgctaagaccagtttcatcggg
cgcgtcgggaatgatgccaacgctgctttcatgcgcggcgaattggtgaaaaatcaaatt
gatacccaatatgttgcaaccaccgcagacacggaaaccggacaggcatatattctgctc
caagcatcgggccaaaactcgatcatcattcaacatggcgccaactttgaactgacgcca
gcggatgtgcagcgggcgactggcttgattcaatcggctgactttgtggttgctgaactg
gaaacgccggtagccgccacagccgaagcattcaaaatcgccaaagctgcggataaagta
accatcttaaaccccgcaccggcgcaaaaagatctgccagaagcgctgctgaaaaatgtt
gatctaatcgcacctaacgagactgaaagcgaattgatcaccggcattccggttaccgat
gaagccagcatgcgccagtccgccgcgtattatcatcaactcggcatccgcggggtggtc
atcaccctcggctcgaaaggttctttcatttcgctaaatggtcaggcaaccctcgtcccg
gccttcaaggtcaaagccgtagataccacggcagcaggggatacctttatcggtgcttta
gtcagcaaccttcagcccgatctcggcaatattgtcgatgccgcaacttacgccagcatg
gccagctcgtttactgtccagaagctcggcgcattcccgtcgattccgatgggggatgag
gtgcgtgcggggttggcaaaggttaaaatgggtcctgcgtaa

DBGET integrated database retrieval system