KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_0431Help
Entry
LOCK908_0431      CDS       T02731                                 

Definition
Class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LOCK908_0431
Enzymes [BR:lrc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LOCK908_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(437884..438663)
Genome map
AA seq 259 aa AA seqDB search
MTMFKAPKGRIMFEHEREDLAKVVKIVMERDDTNIAGGNISFKVSAEDTGKEYIIMTPTM
MSEAYLGDLAPEQILVVEPHTRKIIAGEGNLTREINMHEAVYDANPDIKCVFHSHAKNAM
FWATSGLNMPNITEATQKVGFIETLPFEPNCSEPLAELVSANIAKIGEKAIPHMYLLNSH
GVLITTGGKDMDGLTALHSALAIVDTVEWNADIAFKQTLMQKLGLLDGYYSKGNKIGSLE
DLEDGTPIYNRKAVAVNGD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgactatgtttaaagcacctaagggtcgaattatgtttgaacatgaacgcgaagatctt
gccaaagttgtaaaaatcgtgatggaacgcgatgatacaaatattgcaggcggaaatatt
tcttttaaagtgagtgcggaagataccggaaaagaatatatcatcatgacgccgacaatg
atgtccgaggcatatttgggcgatctggctccagaacaaatcttggttgttgaacctcac
acccgtaagattatagctggcgaaggaaatttgacccgcgaaattaatatgcatgaagcg
gtttatgacgcaaatcccgacatcaaatgcgttttccattcacacgctaagaatgctatg
ttttgggcaaccagtggcctgaacatgccgaatatcaccgaagcaactcaaaaggtaggc
tttattgaaacccttccattcgaaccgaactgttcagaaccattagcggaactggtctcc
gctaacattgccaagattggtgagaaagcaatcccgcatatgtatcttttgaatagccac
ggtgtgctcattaccactggtggcaaagatatggatggattgaccgcacttcattctgca
cttgcaattgtagatacagttgaatggaatgccgatatcgcctttaaacaaaccctaatg
caaaagttaggtcttttagacggttactactctaagggaaacaagattggctcattggaa
gatttagaagacggaacacccatttacaaccgtaaagcagtggcagttaacggtgactag

DBGET integrated database retrieval system