KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_0750Help
Entry
LOCK908_0750      CDS       T02731                                 

Definition
Alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lrc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LOCK908_0750
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOCK908_0750
   00620 Pyruvate metabolism
    LOCK908_0750
   00650 Butanoate metabolism
    LOCK908_0750
  Lipid metabolism
   00071 Fatty acid degradation
    LOCK908_0750
  Amino acid metabolism
   00350 Tyrosine metabolism
    LOCK908_0750
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LOCK908_0750
   00626 Naphthalene degradation
    LOCK908_0750
Enzymes [BR:lrc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LOCK908_0750
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LOCK908_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755502..758108
Genome map
AA seq 868 aa AA seqDB search
MLKNTAKAATEVDVKGMIDELVANAHSALKIMKTFDQEKIDHIVHRMAIAGLDHHMELAK
LAVDETGRGVWEDKAIKNMFATEEIWHSIKNNKTVGVINEDKQRGLVSIAEPIGVIAGVT
PVTNPTSTTIFKSEISIKTRNPIIFAFHPGAQKSSARALEVIREEAEKAGLPKGALQYIP
VPSMEATKTLMDHPGIATILATGGPGMVKSAYSSGKPALGVGAGNAPAYIEASANIKQAV
NDLVLSKSFDNGMICASEQGAIVDSSIYDAVKKEFEAQGAYFVKPKDMKKFESTVINLEK
QSVNPRIVGQSPKQIAEWAGIQIPDDTTILIAELKDVGKKYPLSREKLSPVLAMVKADGH
EDAFKKCETMLDIGGLGHTAVIHTADDELALKFADTMQACRILINTPSSVGGIGDLYNEM
IPSLTLGCGSYGGNSISHNVGTVDLLNIKTMAKRRNNMQWMKLPPKIYFEKNSVRYLEHM
EGIKRAFIVADRSMEKLGFVKIIEDVLARRENPVQVQTFVDVEPDPSTDTVFKGTDIMRS
FGPDTVIAIGGGSVMDAAKGMCLFNDAGDADFFGAKQKFLDIRKRTYTFPKLNKTKLVCI
PTTSGTGSEVTPFAVITDSKAGIKYPLADYALTPDIAIVDSQFIESVPPVVVADSGIDVL
CHATESYVSTMATHYTKGLSLEAIKLVFENLEKSYHGDIAAKSKMHDASTIAGMAFANAL
LGINHSIAHKLGQAFHLPHGRCIAITMPHVIRFNASQPKKRAIWAKYSYFRANEDYAEIA
RYLGLPGKTTDELVESYVQAFIKLAHSVGIKLSLKDQGVQKADLDKQVDRLAELAYEDNC
TVTNPQEPLISDLKHIILDEYEGTDSTF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagaatactgcgaaggctgctactgaagttgatgtgaaaggcatgattgatgaa
ctggttgccaatgcgcactcggctttgaagatcatgaagacttttgatcaagaaaaaatt
gatcatattgttcatcgtatggcaattgccgggttggatcatcatatggaattagcgaaa
ctcgctgttgacgaaaccggccgtggtgtttgggaagataaagccattaaaaatatgttt
gccactgaagaaatctggcattcgattaagaacaacaagaccgttggcgttatcaatgaa
gataaacaacgcggcttggtatccatcgccgaaccaatcggggttattgccggggtaacg
ccggtgaccaacccgacatcaaccacgatctttaaatccgaaatttccatcaagacccgt
aatccgattatctttgctttccatccgggtgcacaaaagtcttcagcgcgtgcgttggag
gtcattcgggaggaagctgaaaaggccggattgccaaaaggggccttgcagtatattccg
gttccaagcatggaagcaactaagacactgatggatcatcccggcattgccacgatcttg
gcaaccggtggccctggcatggttaagtcagcttattcatccggcaaaccggccttgggt
gttggcgcagggaatgcaccggcatacatcgaagcaagtgccaatattaagcaggctgtt
aatgatttggtcttgtccaagagttttgataacggtatgatttgtgcttccgaacaaggg
gccatcgttgattccagcatttacgatgccgtgaagaaagaatttgaagcccaaggtgcc
tattttgtcaaacctaaggacatgaagaagttcgagagcacggttattaaccttgagaag
caaagtgtcaatcctcgaattgttggccaaagtcctaagcaaattgctgaatgggcaggg
attcaaattcctgatgacacgaccatcctgattgccgaattaaaagacgttggcaagaaa
tatccgctttctcgggaaaaactgagcccggttttggcgatggttaaagccgatggtcat
gaagatgccttcaagaaatgtgaaaccatgttggatatcggcggcttgggacacaccgcg
gtgattcacacagctgacgacgaattggcattgaaatttgctgataccatgcaggcttgc
cgtatcctgatcaatacaccttcttctgttggcggtatcggggatctctacaacgaaatg
attcctagtttgacgctgggctgcggctcctatggcggcaactcgatttcgcacaatgtg
gggacggttgacttgttgaatatcaagaccatggcaaaacggcgcaacaacatgcaatgg
atgaaattgccgccaaagatttatttcgaaaaaaactcggttcgctatctggaacacatg
gaaggcatcaagcgcgccttcatcgttgctgatcgttcaatggaaaagctgggtttcgtc
aagatcattgaagacgttttggctcggcgggagaatccggtacaggttcagacgttcgtg
gatgttgaacctgatccatcaaccgatacggtcttcaagggaaccgacatcatgcggtcg
tttggtccggataccgtgatcgcgattggcggtggttctgtaatggatgcagccaagggt
atgtgcttgttcaacgatgctggcgatgcggacttcttcggtgccaagcagaaattcctg
gatattcggaaacggacctacactttcccgaagctgaataagaccaaactggtttgcatt
ccgacgacttccgggaccggttctgaagtgacaccatttgcggttatcactgattccaaa
gcagggatcaaatatccgttagctgattatgctttgacgccagatattgcgattgtggat
agtcagtttattgaatcagtaccgccagtagttgtggctgattccgggatcgatgttttg
tgccatgcaaccgaaagctatgtatcaaccatggcaacccactatacgaaggggctgagc
cttgaagcaatcaagctagtgtttgaaaacctcgaaaagagttatcatggcgacattgcg
gctaagtcaaagatgcatgatgcttctaccattgcagggatggcgtttgccaatgcctta
ctggggattaaccacagtattgcccataaattaggtcaggcgttccacttaccacatgga
cgctgcatcgccatcactatgccacacgttatccggttcaatgctagtcaaccaaagaaa
cgtgcaatctgggccaagtacagttacttccgtgctaacgaagactatgcagaaattgcc
cgctatcttgggctgccaggaaagaccaccgatgaattagtagaaagctatgttcaagcc
ttcattaaattggcacatagcgtcgggatcaagttaagcctgaaggatcagggggttcag
aaagcggatctggacaagcaagttgatcgccttgctgaacttgcttatgaagataactgc
acggttaccaacccgcaggaaccattgatcagcgatttgaagcacattattctcgatgaa
tatgaaggaacagattcaacattctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system