KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_1017Help
Entry
LOCK908_1017      CDS       T02731                                 

Definition
Carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Brite
Enzymes [BR:lrc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LOCK908_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
983925..984659
Genome map
AA seq 244 aa AA seqDB search
MIFRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRAGYGVYVPLFSGHGTVEPLD
ILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPI
LPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPT
FIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQ
ENEG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgattttccgcaaaccacaaccattcgaatatgaaggtaccgatactggcgtggtattg
ttacatgcatacacgggtagccccaatgatatgaattttatggcgcgggccttgcagcga
gccggttatggggtttatgttccgcttttttccgggcatgggacagtggagccgttagac
attttgacaaaaggcaacccggatatttggtgggcagaaagtagtgccgcggttgcgcat
atgacggcaaaatacgccaaggtgtttgtttttggcttatcactgggaggtattttcgcg
atgaaggcgctagaaaccttgccagggattacagcaggcggtgttttttcatccccgatt
ttgccgggcaaacatcacttagtaccgggttttttaaagtatgccgagtatatgaatcgg
ttagcaggcaaatcagatgaaagcacacagattctggcatatttgccgggacagttggcc
gcaatcgatcagtttgccacgacggttgctgctgatttaaatttagtcaaacagccgact
tttattggacaagccggtcaggatgaattagttgatggtcgattagcgtatcaattacgc
gatgccttaatcaatgctgcacgcgttgattttcattggtatgatgatgccaagcatgtc
attaccgttaactcggcccatcacgcattagaagaagacgtaatcgcatttatgcaacaa
gaaaacgagggatag

DBGET integrated database retrieval system