KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_1818Help
Entry
LOCK908_1818      CDS       T02731                                 

Definition
Multimodular transpeptidase-transglycosylase
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
Peptidoglycan biosynthesis
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lrc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LOCK908_1818
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    LOCK908_1818
Enzymes [BR:lrc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     LOCK908_1818
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LOCK908_1818
Glycosyltransferases [BR:lrc01003]
 Polysaccharide
  Bacterial polysaccharide
   LOCK908_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1781843..1783885)
Genome map
AA seq 680 aa AA seqDB search
MQVLSRVWQSIRWFFRRFQVIRWLILLGLTVILIFSAWFTYKAKTADVQNIKSTLQTKTV
IYDANNEEAGTLYGQKGTYVELSAISPQVQNAVISTEDRTFYSNGGFSIKGILRSALNYV
IHHGQIMGGGSTITQQLAKNTLLTQKQTMLRKAQELFMAIQLNKVYSKQDILAMYLNNAY
FGNGVWGVQDAAKRYFGKNASQLDASEGAILAGMLRNPSYYNPADHKDNAISRRNVVLQL
MVDNHKLTQAQANAAKAQSVQVVDAFSNANAQKYPSYFDSVIEEARSEGISVDDILNKGY
KIYTNLDQTYQQNLQTSFEQDWAFPANAADGKQVQGASIILDPKTGGVRAVVGNRGEHTF
LGFNYATQLRNSPGSTIKPLMVYTPALENGYHYDSILKDEKLSYGKNNYTPTNATGTYLG
TVPMYQALADSINAPAVWLLNKLGVQKGVASLDRFGIQLKSSDQNLAAALGGLKNGVSPL
MLARAYAAFANDGKLPTTHFIRKIVDASGETVVDNSHPATRQIMSKKVAQEMTSMMIGTF
NEGTGKTAKPSGYTIAGKTGSTEVPSSWGYGTKDQWVVGYTPDIVNATWIGYPTTDSQHF
LQGTSTSGVAPLFKLEMSKLMPNTPQTAFDTKDAAQMASIQTPGKSDDTWQGIQDSIDKG
IDSAKETVGKWYDNIKSWFK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttctatcacgtgtctggcagagcattcggtggttcttccgccgatttcaggtc
attcgctggctcattttacttgggttgacggtcatcctgatcttctctgcctggttcact
tataaagcaaaaaccgctgatgttcaaaatatcaagagcaccttacagaccaaaacagtt
atttacgatgctaacaatgaagaagcggggacattgtacggtcaaaaagggacgtatgtt
gaactcagtgcgattagtccgcaagtccaaaatgcggttatttcaaccgaagaccggacg
ttttactcgaatggcggcttttccattaaaggaattttgcggtcggcgttgaactatgtt
atccatcatggtcaaattatgggtggtgggagcaccatcacgcaacaattagccaaaaat
acgttactgacgcaaaagcagaccatgctgcgtaaggcacaagagctattcatggcgatt
caactgaataaagtttactccaagcaggatattctcgcgatgtatctcaacaatgcctat
tttggtaatggggtttggggcgttcaggatgctgcaaaacgttatttcggcaagaatgcg
agtcaactggatgccagtgaaggtgctattttagcagggatgttacgtaacccgagttat
tataatccggctgatcataaagacaacgcgatttcgcgacgtaatgtggttttgcagcta
atggtggataaccacaaattgactcaggcgcaggcaaatgcagctaaagcgcaatcggtt
caggtggtggatgctttttcaaacgccaacgcacagaaatatccatcttactttgattcg
gtcatcgaagaagcgcgcagtgaggggattagcgttgatgatattctgaataaaggctat
aagatctacaccaatctggatcaaacctatcagcagaatctgcaaaccagttttgaacag
gactgggcttttccggctaatgcagcagatggtaaacaggttcaaggcgcatcaattatt
ctggatcccaagactggcggcgtgcgcgcagttgtcggcaaccggggcgaacataccttc
ctagggtttaattacgcgactcagctgcgtaattcgccgggatcgactatcaagccgctg
atggtgtacacaccagcgttagaaaacgggtatcactacgactcgattctgaaagacgaa
aagcttagctacggcaaaaataattataccccgacaaacgcgaccggcacataccttggc
accgttccgatgtatcaagcactggcggattcgatcaatgcccctgctgtttggttactc
aacaaactcggggtacaaaaaggcgttgccagccttgatcgttttggcattcagctcaaa
tcgagtgatcagaatctagccgcagcccttggcggtttaaaaaacggggtttcaccgttg
atgctggcgcgggcatacgcggcgtttgctaacgatggcaagctgccgaccacgcacttt
attcggaaaatcgttgatgcgagcggcgaaacggtggttgataattcccatccggcaacg
cgtcagatcatgtccaaaaaagtcgctcaggaaatgaccagtatgatgatcggtacgttt
aacgaaggcaccgggaaaacggctaaaccgtctggctatacaattgctggtaaaactggc
agtaccgaggttcctagcagttggggttatggcaccaaggatcagtgggtagttggttat
acgccggatattgtgaatgcaacttggattggttatccgacaacggatagccagcacttt
ttgcaaggtaccagcacatccggtgtggccccgttgttcaagcttgaaatgtcgaagctg
atgcccaatacacctcaaactgcctttgacaccaaggatgccgcccaaatggccagcatc
caaacaccgggaaaaagtgatgacacttggcaaggaattcaagatagtatcgataaaggt
atagacagtgccaaggaaactgtgggaaaatggtatgataatattaagagctggttcaaa
tag

DBGET integrated database retrieval system