KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_2093Help
Entry
LOCK908_2093      CDS       T02731                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lrc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2067373..2069436)
Genome map
AA seq 687 aa AA seqDB search
MIQGLKDWLYLFNSGQDFQSYNRFGAHEVSPGKWSFLVWAPHAQQIKVVGDFNDWRGSPL
TRQGETGCWYGELAAKKGQLYKYQVVSPDGATHEKIDPYGFGFERKPGSAARLVDIPRIK
WHDGSWLSKRSKWRPYDEPLAIYEVHLGSFIRDTHAGPDGGYMTYQDAIDKLIPYVKELG
YTHIEFLPLMEHPLDASWGYQLMGYFAPTSRFGDPADFLRLVDAAHVAGLGIIMDWVPGH
FIKNTDMLAQFDGTPTFEYTDPHRAENVRWGTWNFDLGKAQVQSFLISSAMYWLDHCHLD
GLRVDAVSNMLYMDYDAGKENDRNRFGGRDNLEGIAFLKQLNTKVFAKHPDVLMMAEESS
AYPKVSAPINTGGLGFNYKWNMGWMNDTLKFFEEDPVYRHSDMNLLTFSFMYMYNEQFVL
PFSHDEVVHGKKSLMHKMPGDRYNQFANLRTMYVWQMTFPGKKLLFMGSEWGQFLEWRDW
SELEWVDLKDPMNHKMQTFTKTLNHIYTNRPSLWQQDHEPLGTKITMADEPDVMSYIRYG
KQKDDFTVVALNFVPVQKDHFRVPVPSLGTYTILLNTENLDFGGTWTKWQATLTARLGDH
YGEPAWLDVILPAMGALLIVPKKLQPLPKKLATEHHQRPSALSGKQPPLAISNQERPAIS
HQRDWGTAPARTQPVKKDLIVKKHKKK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaggattaaaagattggttatacctcttcaactcagggcaggattttcaaagt
tacaatcggtttggtgcccatgaagtttcacctggcaaatggtcgtttctcgtctgggcg
ccacatgcacaacagattaaagttgtcggcgattttaacgattggcgcggcagtccgctg
acccggcaaggagaaaccggctgttggtacggcgaactcgcagccaagaaaggacagttg
tataagtaccaggtggtcagtccggatggggccacacatgaaaagattgatccatatggg
tttggatttgaacgtaagccaggcagcgctgcccgactggttgatattccgcgaatcaaa
tggcatgacggttcgtggctaagcaagcgtagtaagtggcgaccgtatgatgaacccttg
gcaatttatgaagtacacttaggttcttttatccgcgatacacatgccggtccggatggc
gggtatatgacctatcaggatgcgattgataagctgattccttacgtcaaggaactgggt
tatacccatattgagtttctgccgttgatggagcacccgcttgacgcttcatggggctat
cagctgatgggctactttgccccgacaagccggtttggcgacccggcagattttctgaga
ttggtggatgccgctcacgtcgccgggctgggcatcatcatggattgggtgccagggcat
ttcattaagaataccgatatgctcgctcaattcgatggtaccccgacgtttgaatacacc
gatccgcaccgcgccgaaaatgttcgctggggaacctggaattttgatttaggcaaagca
caagtgcaaagctttctgatttccagcgcgatgtactggcttgatcattgtcatcttgat
gggctgcgcgttgatgcggtctcgaatatgctgtacatggattatgacgccggcaaagaa
aatgatcgcaatcggtttggcggccgcgataatcttgagggcattgcctttttgaagcag
ctgaatacgaaggtgtttgccaagcatccggatgtcttgatgatggccgaggaaagttca
gcctatcctaaggtgtccgcgccgattaataccggtggcctagggttcaattacaaatgg
aacatgggctggatgaacgatacgctgaagttctttgaagaagatccggtttatcgccac
agtgatatgaatttattgacgttttcatttatgtatatgtataacgaacaattcgttttg
ccattttcccacgatgaagtcgttcacgggaagaagagcctgatgcacaagatgccgggc
gatcggtacaaccagtttgccaatctacgcaccatgtacgtgtggcaaatgacgtttccg
gggaaaaagctattattcatgggcagtgagtggggtcaattccttgaatggcgtgactgg
agcgagcttgagtgggttgatttgaaagacccgatgaaccataaaatgcaaacttttacg
aaaacgctgaatcatatctatacaaaccgaccgagtctgtggcaacaggatcatgaacca
cttggcactaagatcacaatggcggatgaaccggatgtcatgagttacatccgttatggc
aagcaaaaagatgacttcacggtggtcgcgttaaattttgtcccggtgcaaaaagaccac
ttccgcgtgccagtcccaagcttgggcacgtacacgattcttttgaatacggaaaacctt
gactttggcggtacctggaccaaatggcaggcgactttaaccgcccgactaggtgatcat
tacggcgagccggcttggttagatgtgattttgccagcaatgggcgcgttactaattgtt
cccaaaaaactgcagccgttgcctaaaaagttggcgactgagcaccaccagcggccatcc
gcactttccggaaagcagccgccactggcaatttcaaatcaggaacgaccggccatcagt
catcaacgcgactgggggacggcgcctgcccgaacgcaaccggtgaaaaaagacctgatt
gttaagaagcataagaagaagtga

DBGET integrated database retrieval system