KEGG   Lactobacillus reuteri DSM 20016: Lreu_0171Help
Entry
Lreu_0171         CDS       T00535                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lreu_0171
   01230 Biosynthesis of amino acids
    Lreu_0171
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lreu_0171
   00051 Fructose and mannose metabolism
    Lreu_0171
   00562 Inositol phosphate metabolism
    Lreu_0171
Enzymes [BR:lre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lreu_0171
Exosome [BR:lre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lreu_0171
  Exosomal proteins of bladder cancer cells
   Lreu_0171
  Exosomal proteins of melanoma cells
   Lreu_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
203219..203989
Genome map
AA seq 256 aa AA seqDB search
MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAFALPSMVQAADDSGLK
IIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHEDNELVNRKVLAALQMG
VTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGVSLDQIKNVVVSYEPSWAVGYGQHANP
VLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMIMNKPDVDGVLIGRASLDV
DNFLRMVNYLKNDQEK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccctttattgctgctaattggaagatgcataagaatgtccaagaatcggtt
gaatttgtggatgcaattaaaggaaagctaccagatccgcaagaagttgaagtcggaatt
gcagcccaagcttttgcattacccagtatggttcaagccgctgatgattcaggattaaag
ataatcgcgcaaaacgcggcggctgaatattcgggagctttcactggtgaaattagctta
cgaggtttagctgacgccggtgtttcatatgtaatgttaggacatattgaacggcgccat
ttattccacgaggataatgagttggttaatcggaaagtgttggcagcccttcaaatggga
gttaccccgataatttgtacggatgaaacgatggtccagaaagaagttaatggtgaaatt
cactacgttttccagcaattgatgagcgtattgaggggcgtttctcttgatcaaattaaa
aatgtagttgtttcctatgaaccaagttgggcagttggatatggtcagcatgctaatcca
gttcttgctgaagaaggatgccgtcaaattcggcgaacgattgctgataactacacttat
gagattgctgataagatcaggattctttatgggggcagtgtcaatccagataatatcgga
atgattatgaacaagccagatgtagatggggtattaatcggtcgggcaagtttagatgtt
gataattttttgcgaatggtcaattatttaaaaaatgatcaagaaaaataa

DBGET integrated database retrieval system