KEGG   Lactobacillus reuteri DSM 20016: Lreu_0171Help
Entry
Lreu_0171         CDS       T00535                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:lre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lre00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lre00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:lre00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
203219..203989
Genome map
AA seq 256 aa AA seqDB search
MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAFALPSMVQAADDSGLK
IIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHEDNELVNRKVLAALQMG
VTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGVSLDQIKNVVVSYEPSWAVGYGQHANP
VLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMIMNKPDVDGVLIGRASLDV
DNFLRMVNYLKNDQEK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccctttattgctgctaattggaagatgcataagaatgtccaagaatcggtt
gaatttgtggatgcaattaaaggaaagctaccagatccgcaagaagttgaagtcggaatt
gcagcccaagcttttgcattacccagtatggttcaagccgctgatgattcaggattaaag
ataatcgcgcaaaacgcggcggctgaatattcgggagctttcactggtgaaattagctta
cgaggtttagctgacgccggtgtttcatatgtaatgttaggacatattgaacggcgccat
ttattccacgaggataatgagttggttaatcggaaagtgttggcagcccttcaaatggga
gttaccccgataatttgtacggatgaaacgatggtccagaaagaagttaatggtgaaatt
cactacgttttccagcaattgatgagcgtattgaggggcgtttctcttgatcaaattaaa
aatgtagttgtttcctatgaaccaagttgggcagttggatatggtcagcatgctaatcca
gttcttgctgaagaaggatgccgtcaaattcggcgaacgattgctgataactacacttat
gagattgctgataagatcaggattctttatgggggcagtgtcaatccagataatatcgga
atgattatgaacaagccagatgtagatggggtattaatcggtcgggcaagtttagatgtt
gataattttttgcgaatggtcaattatttaaaaaatgatcaagaaaaataa

DBGET integrated database retrieval system