KEGG   Lactobacillus reuteri DSM 20016: Lreu_0190Help
Entry
Lreu_0190         CDS       T00535                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lreu_0190
  Amino acid metabolism
   00300 Lysine biosynthesis
    Lreu_0190
Enzymes [BR:lre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Lreu_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(222868..224013)
Genome map
AA seq 381 aa AA seqDB search
MEVSEKVKVLQDLIKIHSVNGNEVEVAHYLQKLLSSHGIDSKVDEFGDRRANLIAEIGTG
ESKKILGLTGHQDTVAVPNPDRWQHDPFGGEINGDYVFGRGAADMKSGLAAQAIVLIELK
EAGQLPSGTVRFIATAGEELGTPGAYRLQKQGVADDLDALVVGEPTGGNVIFAHSGSMNY
RVTSYGKSCHSSHPQNGINAIEGLLKFIEEEKHLFDNSKDDQYLGKVQHSITVIDGGSQV
NTIPDSASLHGNIRPTAAFNNIKVADRLNDALEYINHTTPFQLELKIIQDFYPIATEPNN
DFVQIALNAAQRNYPNDIKLDIINGATDASVFTLNRPDLPVVILGCDDWNAAHQNDEYTT
ISSYVATIKAYKQIIRDFFKE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcagtgaaaaagtcaaagtactgcaagatttaataaaaatccattctgtcaat
ggaaatgaagttgaagtagcccactacttacaaaaacttttatcaagtcacggaattgat
tcaaaagttgatgaatttggtgaccgccgtgcaaatttgatcgcggaaatcggaactggt
gaaagcaaaaaaattcttggacttactgggcaccaagacactgtggcagtacctaatcca
gatcgctggcaacatgatccctttggcggtgaaattaacggtgattatgttttcggtcgg
ggagccgctgacatgaaaagcggtctggctgctcaagccatcgtcttaatcgaattaaaa
gaagctggtcaactgccatcaggaacggttagatttattgctaccgccggagaagaactt
ggtactcctggtgcctatcgattacaaaaacaaggagttgccgatgatcttgatgcatta
gtagtcggtgaaccaactggcggaaacgttatttttgctcactcaggaagtatgaactat
cgtgttactagctatggaaagtcttgtcatagttcacatccgcaaaacggtattaatgca
attgaagggttgctaaagtttatcgaagaagaaaaacacctttttgataatagcaaggat
gatcagtatctcggtaaagtgcagcatagtattacagttattgatggcgggtcacaagtt
aataccatccccgacagcgctagtttacatggcaacattcgtcccacggcagcatttaat
aatattaaagttgcagatcgattaaacgatgcgcttgaatacattaatcacacaactccc
ttccaattagaactaaaaattattcaagatttctatcccattgcaacagaacctaataat
gattttgtccaaatcgccctcaatgctgctcagcgcaattatccaaatgatatcaaactc
gatattatcaatggtgcaacagatgcgagtgtatttacattaaatcggccagatcttccg
gttgtaattttaggttgtgatgattggaatgcggctcatcaaaatgatgaatatacaact
atttccagttacgtcgctacaattaaagcttataagcaaattattcgtgatttcttcaaa
gaataa

DBGET integrated database retrieval system