KEGG   Lactobacillus reuteri DSM 20016: Lreu_0232Help
Entry
Lreu_0232         CDS       T00535                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lreu_0232
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lreu_0232
Enzymes [BR:lre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Lreu_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
268228..269505
Genome map
AA seq 425 aa AA seqDB search
MKKMIIQGGNRLSGEVTIGGAKNSTVALIPAAILADTPVEFDTVPDILDVHNLMIILESM
NVKSEFSHGVLDIDPTQIVEAELPSKAIKSLRASYYFMGALLGRFHRATLTFPGGDNIGP
RPIDQHLKAFKALGATVIEEKGTVHLDAPNGLHGSRIFLDMVSVGATINAILAAVRAEGT
TIIENAAREPEIIDLATFLNNMGAKIRGAGTDTIRITGVKTLQSMNTHTIIADRIEAGTY
LSLAAALGDGVMIHNVIPEHLESFTSKMIEMGVELQIDSDKIYVPKSSHLHPVTVKTMPF
PGFATDLQQPLTPLMSLADGDSTIVDTIYPKRVKHISQLQKMGMKIEAHDGMIIVKHTEK
LHGAEVSAGEIRAGAALTIAGLMADGQTVINNAGNILRGYDRIVWKLNRLHANVSIEDDS
SVKIG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgatcattcaaggaggaaaccgtctttctggcgaagtcacgatcggtggt
gccaaaaatagtacagtggcattaattccagctgctattcttgcggatacccctgtagag
tttgacacggttccagatatcttggatgttcacaatctgatgattattttggagtcaatg
aatgtaaagtccgagtttagtcacggagttttagatattgatccaacacaaatcgtagaa
gctgaacttccaagcaaggcaattaaaagtcttcgggcttcctattactttatgggtgca
ttattaggtcgtttccatcgcgcgacattaacatttccgggaggcgataatatcggcccc
cgcccaattgaccaacacttaaaagcatttaaagcacttggagcaaccgttatcgaagaa
aagggtactgttcatttagatgcgccgaatggcttacatgggtctcggatctttttagat
atggtatcagttggtgcaacgattaatgctatcttagcagctgttcgcgctgaaggaaca
acgattattgaaaatgcagctcgtgagccggaaattatcgacttggcaacattcttaaat
aatatgggtgccaaaattcggggtgctggaaccgatactatccgtatcactggagtaaag
acacttcagtcaatgaatactcatacaattattgctgatcgaattgaagcaggaacatac
ctatccttggcggcagcgcttggtgatggggttatgatccataatgttattcctgaacac
ttagaatcatttaccagtaaaatgattgaaatgggtgttgaacttcaaatcgatagcgat
aagatttatgtaccaaaatccagtcatttacatccggttactgttaagacaatgccattc
cctggttttgctactgatttacaacaaccgcttaccccattgatgtcacttgctgatggt
gatagtacgattgttgataccatttatcccaagcgtgtaaagcacatttcccaattacaa
aaaatggggatgaagattgaagcacatgatgggatgattatcgttaaacatacagaaaag
cttcatggcgcagaggtctctgcaggtgagattcgtgccggagcagctttaaccattgct
ggattaatggcagatggacagactgtaattaataatgccggaaatattttacggggttac
gatcgaattgtatggaagcttaatcgccttcatgccaatgtttctattgaggacgattct
tcagtaaaaattggttag

DBGET integrated database retrieval system