KEGG   Lactobacillus reuteri DSM 20016: Lreu_0237Help
Entry
Lreu_0237         CDS       T00535                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00010  Glycolysis / Gluconeogenesis
lre00051  Fructose and mannose metabolism
lre00562  Inositol phosphate metabolism
lre01100  Metabolic pathways
lre01110  Biosynthesis of secondary metabolites
lre01120  Microbial metabolism in diverse environments
lre01130  Biosynthesis of antibiotics
lre01200  Carbon metabolism
lre01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lreu_0237
   00051 Fructose and mannose metabolism
    Lreu_0237
   00562 Inositol phosphate metabolism
    Lreu_0237
Enzymes [BR:lre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lreu_0237
Exosome [BR:lre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lreu_0237
  Exosomal proteins of bladder cancer cells
   Lreu_0237
  Exosomal proteins of melanoma cells
   Lreu_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ82507
JGI: Lreu0237
UniProt: A5VI33
Position
273350..274129
Genome map
AA seq 259 aa AA seqDB search
MRKPFIIANWKMNKNVHESVAFVKAIKEKLPADKEIGIAAQAVSLYNMKKVASSSNLQII
AQNASAELEGPYTGEISMRSLADAGVTYVMLGHLERRRLFNESNDSINQKVLAALNAGII
PIICTDEEMVQTEVNGQIHYVFRQLKSVLKGVPANKLSQIVISYEPSWAVGSTHQANPDI
AEEGCQAIRQSLVEMYGNEIGEQVRILYGGSVNPENIGQIMSKPNVDGALIGRASLEIES
FLQMINYIELASKQKLQVI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccgtttattattgcgaactggaaaatgaataaaaacgttcatgaatctgtt
gcgtttgttaaagcaattaaagaaaagctcccggcagataaagaaattgggatcgccgcg
caagcagtttcgctatataacatgaaaaaagtggcgagctcttccaacttacaaattatt
gctcaaaatgcatctgctgagttagagggaccatatactggagaaattagcatgcgaagt
ttagcagatgcgggcgtgacatacgtgatgctaggccatttagagcgccgacgccttttt
aacgagagtaatgattcaattaatcaaaaagttttagcagccctcaatgctggtattatt
ccaatcatttgtacggatgaagagatggtccaaacagaagttaacggacaaattcattat
gtatttcgccaactaaaaagcgtccttaaaggggtaccagctaataaactatcacagatt
gttatttcgtatgaaccaagttgggccgttgggagcacgcatcaagcaaatccagacatt
gcggaagagggatgtcaggcaattcgtcaaagcctggttgaaatgtatggtaatgagatt
ggcgagcaagtccgaatactctatggtggcagcgttaatcccgagaacattggtcaaatt
atgagtaaaccaaatgttgatggggcgctaatcggtcgcgcaagtctcgagattgaaagt
ttcttacaaatgattaattatatcgaattagcgagcaagcagaagttacaggtaatttag

DBGET integrated database retrieval system