KEGG   Lactobacillus reuteri DSM 20016: Lreu_0237Help
Entry
Lreu_0237         CDS       T00535                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lreu_0237
   01230 Biosynthesis of amino acids
    Lreu_0237
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lreu_0237
   00051 Fructose and mannose metabolism
    Lreu_0237
   00562 Inositol phosphate metabolism
    Lreu_0237
Enzymes [BR:lre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lreu_0237
Exosome [BR:lre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lreu_0237
  Exosomal proteins of bladder cancer cells
   Lreu_0237
  Exosomal proteins of melanoma cells
   Lreu_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
273350..274129
Genome map
AA seq 259 aa AA seqDB search
MRKPFIIANWKMNKNVHESVAFVKAIKEKLPADKEIGIAAQAVSLYNMKKVASSSNLQII
AQNASAELEGPYTGEISMRSLADAGVTYVMLGHLERRRLFNESNDSINQKVLAALNAGII
PIICTDEEMVQTEVNGQIHYVFRQLKSVLKGVPANKLSQIVISYEPSWAVGSTHQANPDI
AEEGCQAIRQSLVEMYGNEIGEQVRILYGGSVNPENIGQIMSKPNVDGALIGRASLEIES
FLQMINYIELASKQKLQVI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccgtttattattgcgaactggaaaatgaataaaaacgttcatgaatctgtt
gcgtttgttaaagcaattaaagaaaagctcccggcagataaagaaattgggatcgccgcg
caagcagtttcgctatataacatgaaaaaagtggcgagctcttccaacttacaaattatt
gctcaaaatgcatctgctgagttagagggaccatatactggagaaattagcatgcgaagt
ttagcagatgcgggcgtgacatacgtgatgctaggccatttagagcgccgacgccttttt
aacgagagtaatgattcaattaatcaaaaagttttagcagccctcaatgctggtattatt
ccaatcatttgtacggatgaagagatggtccaaacagaagttaacggacaaattcattat
gtatttcgccaactaaaaagcgtccttaaaggggtaccagctaataaactatcacagatt
gttatttcgtatgaaccaagttgggccgttgggagcacgcatcaagcaaatccagacatt
gcggaagagggatgtcaggcaattcgtcaaagcctggttgaaatgtatggtaatgagatt
ggcgagcaagtccgaatactctatggtggcagcgttaatcccgagaacattggtcaaatt
atgagtaaaccaaatgttgatggggcgctaatcggtcgcgcaagtctcgagattgaaagt
ttcttacaaatgattaattatatcgaattagcgagcaagcagaagttacaggtaatttag

DBGET integrated database retrieval system