KEGG   Lactobacillus reuteri DSM 20016: Lreu_0246Help
Entry
Lreu_0246         CDS       T00535                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lreu_0246
   00330 Arginine and proline metabolism
    Lreu_0246
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Lreu_0246
Enzymes [BR:lre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Lreu_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
282268..283209
Genome map
AA seq 313 aa AA seqDB search
MPCVREVLTMQKLEQLIDKNFAETAHGKVANYIPILGIVDPQQLGIAIYDVDEDEIGTAG
MAGTRFAIESIAKVITLILTIKRLGHKRVLAELENGSADYSLSSVLLDDELTEQVHRVNY
LNNSSALLTTALIDQLMGQNSFNALLGFCREICNDPCISLNERLFRSAIMNDKDIHALAY
YMKDKDILETVDQTLITYFMQSSMMVTSQSLANLGAVLANDGIKPWDNERLISHEDNELV
KKLLTTVGSFEESKEYTIKIELPIKSGTGGGLLACAPQKCGIGIFSPALDQHGNSLAGMS
LLQDVVDQLELVV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtgtgagagaggttttgacgatgcaaaaattagagcaattgattgataaaaac
tttgctgaaacagctcatggtaaggttgcaaactatattccgatattaggaattgttgat
ccgcaacaactgggcattgccatttatgacgttgacgaggacgaaattgggaccgctgga
atggcaggaacgcgatttgcgatcgagagtattgcgaaggtcataactttaatattaacg
atcaagagattaggacataagcgcgtcttagcagaactagaaaatggttcggcagattat
agcctaagttcggtactattggatgacgagttaaccgagcaggtccaccgggtaaattac
cttaataattcctccgctttgttaacgacagccttaattgaccagttgatggggcagaat
agttttaatgcccttctcggtttctgccgtgagatctgcaatgacccatgcattagcttg
aatgagcgtttatttcggtcagcaattatgaatgataaagatattcatgcactggcttac
tatatgaaagataaagatattttagagactgttgatcaaacattgataacttattttatg
caaagctcaatgatggtgacatcacagagtcttgctaacctaggagcagtcttggcaaat
gatggaattaaaccttgggataatgagcgtcttattagccatgaagataacgagttggta
aagaaattgctaacaacagttggttcgtttgaagaatcaaaagaatacacaattaaaatt
gaactccctattaaaagtggtactggcggcggcttattggcttgtgccccgcaaaaatgt
ggtattggtatttttagtccagctcttgatcaacatggcaatagtttggcaggaatgagt
ttattacaagatgttgttgatcaattagaattagtagtttaa

DBGET integrated database retrieval system