KEGG   Lactobacillus reuteri DSM 20016: Lreu_0246Help
Entry
Lreu_0246         CDS       T00535                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00220  Arginine biosynthesis
lre00250  Alanine, aspartate and glutamate metabolism
lre00471  D-Glutamine and D-glutamate metabolism
lre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lreu_0246
   00220 Arginine biosynthesis
    Lreu_0246
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Lreu_0246
Enzymes [BR:lre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Lreu_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ABQ82516
JGI: Lreu0246
UniProt: A5VI42
Position
282268..283209
Genome map
AA seq 313 aa AA seqDB search
MPCVREVLTMQKLEQLIDKNFAETAHGKVANYIPILGIVDPQQLGIAIYDVDEDEIGTAG
MAGTRFAIESIAKVITLILTIKRLGHKRVLAELENGSADYSLSSVLLDDELTEQVHRVNY
LNNSSALLTTALIDQLMGQNSFNALLGFCREICNDPCISLNERLFRSAIMNDKDIHALAY
YMKDKDILETVDQTLITYFMQSSMMVTSQSLANLGAVLANDGIKPWDNERLISHEDNELV
KKLLTTVGSFEESKEYTIKIELPIKSGTGGGLLACAPQKCGIGIFSPALDQHGNSLAGMS
LLQDVVDQLELVV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtgtgagagaggttttgacgatgcaaaaattagagcaattgattgataaaaac
tttgctgaaacagctcatggtaaggttgcaaactatattccgatattaggaattgttgat
ccgcaacaactgggcattgccatttatgacgttgacgaggacgaaattgggaccgctgga
atggcaggaacgcgatttgcgatcgagagtattgcgaaggtcataactttaatattaacg
atcaagagattaggacataagcgcgtcttagcagaactagaaaatggttcggcagattat
agcctaagttcggtactattggatgacgagttaaccgagcaggtccaccgggtaaattac
cttaataattcctccgctttgttaacgacagccttaattgaccagttgatggggcagaat
agttttaatgcccttctcggtttctgccgtgagatctgcaatgacccatgcattagcttg
aatgagcgtttatttcggtcagcaattatgaatgataaagatattcatgcactggcttac
tatatgaaagataaagatattttagagactgttgatcaaacattgataacttattttatg
caaagctcaatgatggtgacatcacagagtcttgctaacctaggagcagtcttggcaaat
gatggaattaaaccttgggataatgagcgtcttattagccatgaagataacgagttggta
aagaaattgctaacaacagttggttcgtttgaagaatcaaaagaatacacaattaaaatt
gaactccctattaaaagtggtactggcggcggcttattggcttgtgccccgcaaaaatgt
ggtattggtatttttagtccagctcttgatcaacatggcaatagtttggcaggaatgagt
ttattacaagatgttgttgatcaattagaattagtagtttaa

DBGET integrated database retrieval system