KEGG   Lactobacillus reuteri DSM 20016: Lreu_0288Help
Entry
Lreu_0288         CDS       T00535                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lreu_0288
  Lipid metabolism
   00600 Sphingolipid metabolism
    Lreu_0288
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Lreu_0288
Enzymes [BR:lre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Lreu_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
335463..337349
Genome map
AA seq 628 aa AA seqDB search
MDADIKWLDEPETFRVNQLPAHSDHYYYGNYDEWRHNNSRFAQNLDGQWQFNFAENPRKR
ENDFYKVDYDSSSFGTIEVPSEIELNNYAQNNYINTLIPWEGKIYRRPAYALSPDDAQEG
SFSDGDDNTVGEYLKHFDLEPSLRGKQIRIRFDGVERAMYVWLNGHFIGYAEDSFTPSEF
DLTPYIQDEGNVLAVEVFKHSTASWIEDQDMFRFSGIFRSVNLLAQPLVHVEDLHIRPIV
TDNYQDGIFNVDLQLHGEKTGNVNVRVIDNDGNTLVNETHPVDSTVKVQDQFLENVHLWD
NHDPYLYQLLIEIRDDEGNLVELVPYRFGFRRIEINKDHVVLLNGQRLIINGVNRHEWNA
KRGRAITMDDMTSDIHTFKENNINAVRTCHYPDQIPWYYLCDDNGIYMMAENNLESHATW
QKMGAIEPSYNVPGSVPQWRDVVVDRARTNYETFKNHPSILFWSLGNESYAGDNIVKMNE
FYKKHDDSRLVHYEGVCHTPEYRDRISDVESWMYLPPKEVEEYLKNNPDKPFMECEYMHD
MGNSDGGMGSYISLLDKYPQYFGGFIWDFIDQALLVKDPVSGQEVMRYGGDFDDRHSDYE
FSGDGLMFADRTPKPAMQEVRYYYGLHK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagatatcaaatggcttgatgaaccggaaacattccgcgtcaatcaattacct
gctcatagtgaccattattattacggtaactatgatgaatggcggcataataatagtcgt
tttgcgcaaaacttggatggtcaatggcaatttaactttgctgaaaacccgcgtaaacga
gaaaatgacttttataaggtagattatgatagtagtagttttggaacaatcgaagtgcct
agtgagattgaactaaataattacgcccaaaataattacattaacactttgattccgtgg
gaaggtaagatttaccgtcgtcccgcatatgcccttagtcctgatgatgcgcaagaggga
tcatttagtgatggggatgataatactgttggcgaatacttaaaacattttgaccttgaa
ccttctttacggggaaagcagatccgcattcgttttgatggtgttgagcgtgccatgtat
gtttggcttaatggtcactttattggttacgctgaagacagttttaccccctctgaattt
gacctgactccttacattcaagatgaaggtaatgttttagctgtggaagttttcaagcat
agtaccgcctcgtggattgaggatcaagatatgttccgtttttctggaattttccggagt
gtaaacttattagcccaaccacttgttcatgttgaagaccttcatattcggccaattgtt
actgataattatcaggacggtatttttaatgttgaccttcaacttcacggtgaaaagacc
gggaacgttaatgtgcgggttatcgacaatgatggtaatacgctcgtcaatgaaacacac
cctgttgattccacggtaaaagttcaggatcaatttttagaaaatgttcacttatgggat
aaccatgatccttacctctatcaattgttgattgaaattcgtgatgacgaaggtaatttg
gtcgaactcgttccatatcgttttggttttcggcgaattgaaattaataaagatcatgtt
gtcctattgaatggtcaacggctaattataaatggtgttaaccgtcacgaatggaatgct
aaacgtggccgcgcgatcacgatggatgatatgacgagtgatattcacacctttaaggaa
aataatattaatgccgtccggacgtgtcactatccagaccagattccgtggtattacctt
tgtgatgataacggaatttacatgatggccgaaaataatctggaatcccacgctacctgg
cagaagatgggagcaattgaaccatcatataacgtccctggttcagttcctcaatggcgt
gacgtagtagtagatcgggcgcggactaactatgaaacatttaagaaccacccgtcgatt
ttattctggtcgttaggtaatgaatcatatgctggcgataatattgtcaaaatgaatgaa
ttctataagaagcatgatgacagtcggcttgttcactatgagggtgtttgtcatactccc
gaataccgtgatcggatctcagacgttgaaagctggatgtacttaccacctaaagaagtt
gaggagtacttgaagaacaatccagacaagccatttatggaatgtgagtacatgcatgat
atggggaactctgatggtggaatgggttcatacatttctttacttgataaatacccacaa
tactttggcggcttcatttgggactttattgatcaagccctccttgttaaggatccggta
agtgggcaagaagtgatgcgctatggtggtgatttcgatgatcgtcactcagattacgaa
ttctcgggagatggcttgatgtttgctgatcggacaccgaagccagcaatgcaggaggta
agatactactatggcttacacaaataa

DBGET integrated database retrieval system