KEGG   Lactobacillus reuteri DSM 20016: Lreu_0291Help
Entry
Lreu_0291         CDS       T00535                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lreu_0291
   01230 Biosynthesis of amino acids
    Lreu_0291
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lreu_0291
  Energy metabolism
   00680 Methane metabolism
    Lreu_0291
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lreu_0291
Enzymes [BR:lre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Lreu_0291
Exosome [BR:lre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Lreu_0291
  Exosomal proteins of melanoma cells
   Lreu_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
340329..341039
Genome map
AA seq 236 aa AA seqDB search
MAELVIVRHGQSQANRDNIFTGWTDVPLTPKGIEQGELVGKELLRLGIQFSDAYTSYMER
AIMTTNIILEEINQLYIPVHKTWRLNERHYGALSGRNKDEVKKEIGAEQLHKWRRGFKDL
PPQLKERQHDRRYDRLGVKIPLSESLEMTLQRLLPYWQDHIAPRLIDGHNQLIVAHGSSL
RALIKYLDGISDDDIDKVEVPNGKPILYRFDDHLNVIKKTFITMDGEIDDNTRISK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattagtaattgtacgtcatgggcaaagtcaagctaaccgtgataatattttt
actggctggactgatgttccgttgactcctaaaggaattgaacaaggtgaattagtcggc
aaggaattgctaagactaggtatccaatttagtgatgcgtatacgtcctacatggaacgg
gcaatcatgacaactaatattatcctagaagaaattaatcagttatatattccggttcat
aaaacgtggcgactaaacgaacgtcattatggagcattgagtggtcggaacaaagatgaa
gtgaagaaagagattggtgcagaacagcttcataaatggcggcgtggttttaaagattta
ccaccacaattaaaagagcgtcagcatgatcgccgctatgatcgcttaggagttaagatt
ccgcttagtgagagtttagaaatgacgctccaacgactcctcccatattggcaagaccat
attgcgcctcgtttaattgacggacacaatcagttaattgttgcccatggtagttctttg
cgggcactaattaaatatttagatggtatttcagatgacgatattgataaagtggaagtt
ccaaatggcaagccaattttatatcgctttgatgatcatcttaatgtcattaaaaagact
tttataacaatggatggtgaaattgatgacaatacacgaattagcaaataa

DBGET integrated database retrieval system