KEGG   Lactobacillus reuteri DSM 20016: Lreu_0291Help
Entry
Lreu_0291         CDS       T00535                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:lre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lre00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:lre00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lre00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
340329..341039
Genome map
AA seq 236 aa AA seqDB search
MAELVIVRHGQSQANRDNIFTGWTDVPLTPKGIEQGELVGKELLRLGIQFSDAYTSYMER
AIMTTNIILEEINQLYIPVHKTWRLNERHYGALSGRNKDEVKKEIGAEQLHKWRRGFKDL
PPQLKERQHDRRYDRLGVKIPLSESLEMTLQRLLPYWQDHIAPRLIDGHNQLIVAHGSSL
RALIKYLDGISDDDIDKVEVPNGKPILYRFDDHLNVIKKTFITMDGEIDDNTRISK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattagtaattgtacgtcatgggcaaagtcaagctaaccgtgataatattttt
actggctggactgatgttccgttgactcctaaaggaattgaacaaggtgaattagtcggc
aaggaattgctaagactaggtatccaatttagtgatgcgtatacgtcctacatggaacgg
gcaatcatgacaactaatattatcctagaagaaattaatcagttatatattccggttcat
aaaacgtggcgactaaacgaacgtcattatggagcattgagtggtcggaacaaagatgaa
gtgaagaaagagattggtgcagaacagcttcataaatggcggcgtggttttaaagattta
ccaccacaattaaaagagcgtcagcatgatcgccgctatgatcgcttaggagttaagatt
ccgcttagtgagagtttagaaatgacgctccaacgactcctcccatattggcaagaccat
attgcgcctcgtttaattgacggacacaatcagttaattgttgcccatggtagttctttg
cgggcactaattaaatatttagatggtatttcagatgacgatattgataaagtggaagtt
ccaaatggcaagccaattttatatcgctttgatgatcatcttaatgtcattaaaaagact
tttataacaatggatggtgaaattgatgacaatacacgaattagcaaataa

DBGET integrated database retrieval system