KEGG   Lactobacillus reuteri DSM 20016: Lreu_0328Help
Entry
Lreu_0328         CDS       T00535                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lreu_0328 (recR)
DNA repair and recombination proteins [BR:lre03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Lreu_0328 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
375205..375807
Genome map
AA seq 200 aa AA seqDB search
MIQYPEPLAKLIESYTKLPGIGQKTATRLAFYTLSMQEDDVTNFAKSLLSAKRDLHNCSI
CGNITEDDPCPICRDKTRDHSQILVVEQSQDVMAMERMHEYHGLYHVLHGVISPVAGTGP
EDINITSLLKRLKKDDEVKEIIIATNASSDGELTAGYLAKLIKPAGIKVTRLAHGLSVGA
DIDYADEMTLFKAVQGRTEM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgatccaatatccagaaccattagcgaaattaattgaaagctatactaagttgccagga
atcgggcaaaagactgcaacgcggctggcgttctatactctgagtatgcaagaagatgat
gtgacaaactttgctaaatcccttctgtctgctaaaagggaccttcataactgtagtatt
tgtggcaatattaccgaagacgacccttgtccaatttgtcgcgataagacccgtgatcat
tcgcaaattctagttgttgagcagtcacaagacgttatggcaatggaacggatgcatgaa
taccatggtttataccatgtccttcatggagttatttctccagttgcaggaacaggccca
gaagatattaatattacaagtttacttaaacgactaaagaaagatgatgaagtaaaggaa
attattattgcaacgaatgcttcatctgatggtgagttgacggccggttacctcgctaag
ttaattaagcctgcgggaattaaagttactcggttggcgcatgggttatcagttggcgct
gatattgactatgctgatgagatgacattattcaaagcagtgcaagggcgaacggagatg
taa

DBGET integrated database retrieval system