KEGG   Lactobacillus reuteri DSM 20016: Lreu_0372Help
Entry
Lreu_0372         CDS       T00535                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lre00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lre00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lre00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lre00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
420648..421562
Genome map
AA seq 304 aa AA seqDB search
MKRVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVVVDGKN
KRSIEDHFDSNPELEDNLRSKHKDEMLKMVEETTDVNIYFIRQSHPRGLGDAVLTARDFI
GDEPFVVMLGDDLNNINNKNEALTKQLIESYNQTGASTLAVMRVPHEDTAKYGVINPSKE
VTPGLYNVTSFVEKPAPKDAPSDLAIIGRYVFTPEIFDVLAKTKPGKGGEIQLTDAIDTL
NQTQRVFAREYKGDRYDVGNKFGWVKTNIEYGLEHPQVKEELREYIKELGAKLAAEDKQN
NSKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgttagaaaagccattattcctgctgccggtttaggaactcgttttcttcct
gcaacaaaggcattggcaaaggaaatgttaccaattgttgataagccaacaattcaattt
attgttgaagaagcgcgcaaatcaggaattgaagatattgttgttgttgatggaaagaat
aagcggtcgattgaagaccattttgactctaatccagagttggaagataatcttcgttca
aaacacaaggatgagatgttaaagatggttgaagaaacaaccgatgttaatatttacttc
attcgtcaatctcatcctcgtggtttaggggacgctgttttaactgctcgtgattttatc
ggggatgaaccatttgttgttatgcttggggatgaccttaataacattaacaacaagaat
gaagctttaacaaagcaattgattgaaagttataaccaaactggcgcatctactcttgct
gttatgcgggttccacatgaagatactgcaaagtatggtgtaattaatcctagcaaggaa
gttacgccaggtctctataacgtaactagcttcgttgaaaagccagctcctaaagatgcc
ccaagtgatttagcaattattggtcggtatgtctttactccagaaatctttgacgtattg
gcaaagactaagccaggtaagggcggcgaaattcaattaactgatgcaattgatactctg
aaccaaactcaacgggtattcgctcgtgaatacaagggtgaccgttacgatgttggtaat
aagtttggctgggttaagacaaacattgaatatggtttggaacacccacaagttaaagaa
gaattgcgtgaatacattaaggaattaggcgcaaaacttgctgctgaagataagcaaaat
aattctaagaagtaa

DBGET integrated database retrieval system