KEGG   Lactobacillus reuteri DSM 20016: Lreu_0372Help
Entry
Lreu_0372         CDS       T00535                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00040  Pentose and glucuronate interconversions
lre00052  Galactose metabolism
lre00500  Starch and sucrose metabolism
lre00520  Amino sugar and nucleotide sugar metabolism
lre01100  Metabolic pathways
lre01130  Biosynthesis of antibiotics
Module
lre_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Lreu_0372
   00052 Galactose metabolism
    Lreu_0372
   00500 Starch and sucrose metabolism
    Lreu_0372
   00520 Amino sugar and nucleotide sugar metabolism
    Lreu_0372
Enzymes [BR:lre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Lreu_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABQ82641
JGI: Lreu0372
UniProt: A5VIG7
Position
420648..421562
Genome map
AA seq 304 aa AA seqDB search
MKRVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVVVDGKN
KRSIEDHFDSNPELEDNLRSKHKDEMLKMVEETTDVNIYFIRQSHPRGLGDAVLTARDFI
GDEPFVVMLGDDLNNINNKNEALTKQLIESYNQTGASTLAVMRVPHEDTAKYGVINPSKE
VTPGLYNVTSFVEKPAPKDAPSDLAIIGRYVFTPEIFDVLAKTKPGKGGEIQLTDAIDTL
NQTQRVFAREYKGDRYDVGNKFGWVKTNIEYGLEHPQVKEELREYIKELGAKLAAEDKQN
NSKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgttagaaaagccattattcctgctgccggtttaggaactcgttttcttcct
gcaacaaaggcattggcaaaggaaatgttaccaattgttgataagccaacaattcaattt
attgttgaagaagcgcgcaaatcaggaattgaagatattgttgttgttgatggaaagaat
aagcggtcgattgaagaccattttgactctaatccagagttggaagataatcttcgttca
aaacacaaggatgagatgttaaagatggttgaagaaacaaccgatgttaatatttacttc
attcgtcaatctcatcctcgtggtttaggggacgctgttttaactgctcgtgattttatc
ggggatgaaccatttgttgttatgcttggggatgaccttaataacattaacaacaagaat
gaagctttaacaaagcaattgattgaaagttataaccaaactggcgcatctactcttgct
gttatgcgggttccacatgaagatactgcaaagtatggtgtaattaatcctagcaaggaa
gttacgccaggtctctataacgtaactagcttcgttgaaaagccagctcctaaagatgcc
ccaagtgatttagcaattattggtcggtatgtctttactccagaaatctttgacgtattg
gcaaagactaagccaggtaagggcggcgaaattcaattaactgatgcaattgatactctg
aaccaaactcaacgggtattcgctcgtgaatacaagggtgaccgttacgatgttggtaat
aagtttggctgggttaagacaaacattgaatatggtttggaacacccacaagttaaagaa
gaattgcgtgaatacattaaggaattaggcgcaaaacttgctgctgaagataagcaaaat
aattctaagaagtaa

DBGET integrated database retrieval system