KEGG   Lactobacillus reuteri DSM 20016: Lreu_0393Help
Entry
Lreu_0393         CDS       T00535                                 

Definition
esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lre  Lactobacillus reuteri DSM 20016
Brite
Enzymes [BR:lre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Lreu_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
446790..447566
Genome map
AA seq 258 aa AA seqDB search
MITYTGESFFFPHSGRRGVILLHAYTGNTNDVRMLGRQLNWQGYTVFAPLLSGHGGDPRK
VLESNGPGDWWDDTRMAIFRLRDAGIDQIAIFGLSLGGLLATRALENDPQLLGGGVFASP
ITTWGQSNVPEYFPKIAAEYYRRQKITPLITKEKVAKLTERLPKQLAQIQTMAHQICDQL
DQIHQPFFIAQGGADEMIDPVSGLQLKARLQANGVVVDYHYYPTATHLLTVNTAHRQLFA
DVEKYLQNLFEVSSNDNK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgataacgtatactggtgagtcttttttctttccccatagtggacgtcgtggagttatt
ttgcttcatgcatatacaggaaatacgaatgatgttcgaatgttaggacgtcagcttaat
tggcaagggtatacagttttcgcaccgcttttgagtgggcatggcggtgatccgcgaaaa
gtactagaaagcaatggtccaggtgattggtgggatgatacccggatggcaatctttcgt
ttacgcgatgctggaattgatcaaattgcgatttttggtttatcgctcggtggtttactt
gccaccagggctcttgagaatgatccgcaattattaggtggtggtgtttttgcatcccca
attaccacctggggacaatcaaatgttccggaatactttcctaaaattgcggcagagtat
tatcgtcgacaaaaaattacccccttaattactaaggaaaaggttgctaaattgactgaa
cgactccccaaacaactagcacaaattcaaacaatggcgcatcaaatttgtgaccaatta
gatcagattcatcaacctttctttattgcacagggaggcgcggatgaaatgattgatcca
gtgtctggcctgcaattaaaagcaagattacaagcaaatggggttgtagttgattatcat
tactacccaaccgctactcacttattaacagttaataccgctcatcgtcaattatttgcc
gatgtagaaaaatatttacaaaatttattcgaggtgtcttctaatgacaacaaataa

DBGET integrated database retrieval system