KEGG   Lactobacillus reuteri DSM 20016: Lreu_0404Help
Entry
Lreu_0404         CDS       T00535                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Lreu_0404
Enzymes [BR:lre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Lreu_0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
456412..457335
Genome map
AA seq 307 aa AA seqDB search
MSNNVVVLGSINVDTTYHVDRFPQPGETISAVSKSSAPGGKGANQAVAAARSGAKTAFIG
AVGSDKEGAYMLESLADDHIDTRHIMTDELHGTGSAAITLDANGQNDIMVYGGANQAMAT
DVLNGIDDVLEDADFLISQFETPQEVALNAFKQAKKYGVTTLLNPAPAHEILPELLKYTD
VITPNESECALLTGIEITDEESMLKSADYFRERGVKHLLITLGSKGVFYSTPTAHGLVPA
FKVKAVDTTAAGDTFLGALSSQLEKDLSNVDKALVYAQRASSLTVQQMGAMPSIPNHDAV
IKALAEN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataatgtagttgttttaggaagtattaacgttgatactacttatcatgttgat
cgcttccctcaacctggtgaaactatttcagcagtaagtaagagttctgctcctggtggt
aagggtgccaatcaagcagttgcagcagcccgctctggtgccaaaacggcctttattggg
gcagttggttctgataaagaaggagcttacatgcttgaatcattggctgatgaccatatt
gatacacgccacatcatgactgatgagttacacggtactggtagtgctgcgattacttta
gatgctaatggtcaaaatgacattatggtatatggcggtgccaaccaagcaatggccact
gatgttcttaatggcattgatgatgttttagaagatgctgactttttaattagtcaattt
gaaacaccacaagaagttgctttaaatgcatttaagcaagctaaaaaatacggtgttact
actcttttaaatccagcaccagctcatgagattttaccagagttattaaaatatacagat
gttattacgcctaatgaaagtgaatgcgccttattaacaggtattgaaattactgatgaa
gaatcaatgttaaagagtgctgattacttccgtgaacggggagttaaacaccttttaatt
actttaggctcaaaaggagtattttactccacacctacagctcatggattagttccagca
tttaaggttaaggcagttgatactacagcagctggtgatacattccttggggcattaagt
tcacaattagaaaaggacttatcaaatgttgacaaggcacttgtctacgcacaacgagca
tctagtttgactgttcaacaaatgggagcaatgccttctattccaaaccatgatgcggtt
ataaaagcattagcagaaaattaa

DBGET integrated database retrieval system