KEGG   Lactobacillus reuteri DSM 20016: Lreu_0608Help
Entry
Lreu_0608         CDS       T00535                                 

Definition
ATP-dependent RecD/TraA family DNA helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lreu_0608
Enzymes [BR:lre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Lreu_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
675997..678474
Genome map
AA seq 825 aa AA seqDB search
MAEEIDLFKTPTEPSFFIGQVQSEIFTSPDSFFKVLIVSVEEANFDWHEPEITVTGSFGD
LSDDQTYRFEGKIVEHPRYGQQFQATSYHVNRPTSKDGLIDFLSGKQFTGIGKKTAEKIV
DKLGTDAINKIIADPHVLDELKLRKAVKDSLVDNLRAHQGMDQIIIGLNDLGFGANLSSA
IFDKYGEETLHIINENPYQLAAEIDGISFNRADQVAQKLGIATDDSRRIDAAIIQTLDDL
TMETGDTFTTTKPLLQQTIQLLAQGSGGRVSTDLIANQIVELEKNQAISYADEKIYPTAL
YNAEWQIADHLHRLLTVDQEKVPATTIEKTVTKVADQSGITYDQVQKEAIKTALNSKVML
LTGGPGTGKTTIIKGIVASYAKIHDLSLDVNEYKEKSFPVLLAAPTGRAAKRMSEATDLP
ASTIHRLLGLNGREMPTDMNARDLEGSLLIIDEMSMVDTLLFKTLIQAVPTSMHVVLVGD
KDQLPSVGPGQVFHDLLDFAELPKVELTNIHRQAADSTIIPLAHAIKEGKLPSDLTNKMP
DRSFISCHANQVPSVVQQIIDLSKKRDYSANDIQILAPMYRGQAGIDRLNELAQQAYNPP
ANGKQEVDFRGLTFRVGDKVLQLVNVPEKNIFNGDIGKITAIESGRTVGKKNESITVDFD
GNEVSYSRMEWNQLRLAYCISIHKAQGSQFKMVLLPIVQQFSRMLQRNLLYTAITRAAEK
LVLIGEPYAAVTSVKNEAVNRKTSLVDRLGRVWNRHGELKSNLDHQTDSLTKELASSQPV
QKQTEQLINNDAQQYILTADLINSDTIDPLIGMENISLQSLHQVK
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaatcgacctatttaagacgccaacggagccgtctttttttattggtcag
gtacaatctgagatttttactagtccagattcgttttttaaggttttaattgtctcggtt
gaagaagcaaattttgattggcacgagccggagattactgtaacgggaagttttggtgat
cttagtgatgatcagacttaccgctttgagggaaaaattgttgagcatccgcgatatggg
caacagtttcaagcgacttcttaccatgtcaatcggcccacaagcaaggatgggttaatt
gatttcttgtctggaaaacagtttaccggaattggaaaaaagacggctgaaaaaattgtc
gataaattaggaacggatgcgattaataaaattattgctgacccccatgttttagatgaa
ttaaaactccgcaaagcagttaaggattcattagttgataatttacgagcacaccagggg
atggaccagattattatcggcctaaatgatctcggctttggcgctaaccttagtagtgca
atttttgacaagtacggagaagaaactctgcatattattaatgaaaatccttaccaactc
gctgctgagatagatggaattagctttaatcgggctgatcaggtggcacagaaattagga
atcgccacggatgattcacgtcgaattgatgccgcaattatccagacgcttgatgacttg
acaatggagactggtgatacatttactacaacaaaacctcttctgcagcaaactatccag
ttgcttgcccaaggaagtgggggtcgtgtttcgaccgatttaattgccaaccaaattgtt
gagctagagaaaaatcaagcaattagttatgcggatgaaaaaatttatccaactgccctt
tataacgcggaatggcaaattgctgatcacttacatcgtcttcttaccgttgaccaggaa
aaagtaccagcaacgactattgagaaaacagttacgaaggttgccgatcaatcggggata
acctatgaccaagttcaaaaagaggccatcaaaacagccttaaatagtaaagttatgctt
cttacgggaggcccaggaacgggaaaaacaacaattattaaagggattgtagcaagttat
gcgaaaattcatgatctttcattggacgtaaatgaatataaagaaaagtcatttcctgtt
ttactagctgctcctacaggccgtgctgctaaacgaatgagtgaagctactgatttacca
gcaagtacaattcaccgcttgctagggcttaatggccgggaaatgccaactgatatgaat
gcccgcgatttagaaggctcgttattgattattgatgaaatgtcgatggtcgataccctc
ttgtttaagactcttattcaagccgtccctacttctatgcatgtagttttggtaggtgat
aaagaccaattaccatctgttggtcccgggcaagttttccatgatcttcttgactttgca
gaactgcccaaagttgaactgaccaatattcaccgccaggctgctgattcaacaattatc
ccattagctcatgctatcaaagagggtaagctaccatcagatctaacgaataaaatgcca
gatcgatcatttatctcatgccatgctaaccaagtgccaagtgtggttcaacaaattatt
gacctttctaaaaaacgagattattccgcaaatgatattcaaatcttggcaccaatgtac
cgtggacaggcagggatcgatcgtttgaatgagcttgcacaacaggcgtataatcctcca
gctaatggaaagcaagaagtcgattttaggggactaacttttcgtgttggagataaggtt
ctgcaactcgttaatgttccagaaaagaacatttttaatggtgacattggaaaaatcaca
gcaattgaaagcggtaggacagtcggtaagaaaaatgaatcaattactgtcgattttgat
ggtaatgaagtgagttatagccgcatggaatggaatcaattacggttagcttattgtatt
tcgatccataaagcacagggaagtcagtttaagatggttcttttgccaattgttcagcag
tttagccggatgcttcaacgaaatcttttatatacagcgattactcgtgccgcagaaaag
ctagttttgatcggtgagccatatgcggctgtgactagtgtaaaaaatgaagcagttaac
cgaaaaacttctttggttgatcgcctcggtagggtttggaataggcatggtgaactaaaa
tcaaacttagatcatcaaacagattcattaacaaaagaacttgctagttcccaaccagtt
caaaaacaaactgaacaattaataaataatgatgctcagcaatatattctaacagctgat
ctcattaattcagatacaattgatccattaatcggaatggaaaatattagcttacaaagt
ttgcatcaagtcaaataa

DBGET integrated database retrieval system