KEGG   Lactobacillus reuteri DSM 20016: Lreu_0611Help
Entry
Lreu_0611         CDS       T00535                                 

Definition
(RefSeq) aspartate kinase
  KO
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Lreu_0611
   01230 Biosynthesis of amino acids
    Lreu_0611
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lreu_0611
   00270 Cysteine and methionine metabolism
    Lreu_0611
   00300 Lysine biosynthesis
    Lreu_0611
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Lreu_0611
Enzymes [BR:lre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     Lreu_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(680599..681957)
Genome map
AA seq 452 aa AA seqDB search
MKVVKFGGSSLANGEAFQNAINIITSDPQRRVIVTSAPGKRFADDIKVTDLLIKYAQTVI
AGQNPQEIVEQILNRYQEIAAYFGLPADKLIPLAERLEGLPNHTYPNDNYLLAAFKAHGE
RLNAQLMAILLQHLGYEARFVTPSEAGIIVTGTPNNANVIPETYANLSHFTFNENELLIF
PGFYGLTLAGHIATFSRGGSDITGAILARGLHASTYENFTDVDAIYSANPQIVDHPQPIT
TMTYREMRELSYAGFSVFHDEALIPAIQGNIPINVRNTNDPEKPGTMIVPDKDFQPSDIV
TGVVSGKHFAALYLHKYLLNKQAGFTLRILEILAKHNVSYEHMPSGIDDITIILDRNAIN
DQLIDTICNEIQEEINPDRLEWIDNYAITMVVGEGMRNRTGVIDDILMPLAEKHIAVPMI
NQGASRIAIMIGTYNEDADEAVRAIYHRFFAN
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgtaaagtttggtggaagttctctggctaatggagaagcctttcaaaatgca
attaatattattacctctgacccacaacgccgggtaattgtcacttctgcaccgggtaaa
cgttttgccgatgatattaaggttactgacttactgattaaatatgcccaaacagtaatt
gcaggccaaaaccctcaagaaatcgttgaacaaattttaaatcgatatcaagagattgct
gcttattttggcttaccagcagataaattaattccgctagccgaacgactggaaggcctt
cctaaccatacgtatccaaatgataactatctcttggctgctttcaaagctcatggtgaa
cgcttaaatgcccaactaatggccatccttttgcagcatttaggttatgaagcacgtttt
gtgacaccaagtgaagctggtattattgttactggaactcccaataatgctaatgttatc
ccagaaacatatgcaaacttgagtcattttacgtttaatgaaaacgaattattaatattc
cccggtttctatggtctcacccttgccggacacattgctactttttcccgtggcggttct
gatatcaccggtgcgattcttgcgcgcggtcttcacgcctccacttatgaaaatttcacc
gatgttgatgctatttactcagccaatccacaaattgttgatcatccgcaaccaattaca
accatgacttaccgagaaatgcgggaactatcttacgctggtttttccgtctttcacgat
gaagcactgattcctgccattcaaggaaatattccaatcaatgttcgtaatactaatgac
cctgaaaagccaggaacaatgattgtccctgataaagattttcaaccaagcgacattgta
acgggggtcgtgagcggaaaacactttgcagccctctacctgcacaaatatctccttaac
aagcaagcaggttttactcttcggatccttgaaattctcgcaaagcacaacgtctcatac
gaacatatgccttcaggaatcgatgatataacaattatccttgatcggaatgcaattaat
gaccaattaatcgataccatctgcaatgaaattcaagaagagattaatcctgaccgttta
gaatggattgacaattatgcaattaccatggttgttggtgaaggtatgcgtaatcgcacg
ggggtaatcgatgatattttaatgcccctagctgaaaaacacattgcggttcccatgatt
aatcaaggagcttcacgaattgcaattatgattgggacatacaacgaagatgcagatgaa
gctgttcgagctatttaccatcgctttttcgcaaattag

DBGET integrated database retrieval system