KEGG   Lactobacillus reuteri DSM 20016: Lreu_0611Help
Entry
Lreu_0611         CDS       T00535                                 

Definition
aspartate kinase
Orthology
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:lre01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lre01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lre00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lre00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lre00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(680599..681957)
Genome map
AA seq 452 aa AA seqDB search
MKVVKFGGSSLANGEAFQNAINIITSDPQRRVIVTSAPGKRFADDIKVTDLLIKYAQTVI
AGQNPQEIVEQILNRYQEIAAYFGLPADKLIPLAERLEGLPNHTYPNDNYLLAAFKAHGE
RLNAQLMAILLQHLGYEARFVTPSEAGIIVTGTPNNANVIPETYANLSHFTFNENELLIF
PGFYGLTLAGHIATFSRGGSDITGAILARGLHASTYENFTDVDAIYSANPQIVDHPQPIT
TMTYREMRELSYAGFSVFHDEALIPAIQGNIPINVRNTNDPEKPGTMIVPDKDFQPSDIV
TGVVSGKHFAALYLHKYLLNKQAGFTLRILEILAKHNVSYEHMPSGIDDITIILDRNAIN
DQLIDTICNEIQEEINPDRLEWIDNYAITMVVGEGMRNRTGVIDDILMPLAEKHIAVPMI
NQGASRIAIMIGTYNEDADEAVRAIYHRFFAN
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgtaaagtttggtggaagttctctggctaatggagaagcctttcaaaatgca
attaatattattacctctgacccacaacgccgggtaattgtcacttctgcaccgggtaaa
cgttttgccgatgatattaaggttactgacttactgattaaatatgcccaaacagtaatt
gcaggccaaaaccctcaagaaatcgttgaacaaattttaaatcgatatcaagagattgct
gcttattttggcttaccagcagataaattaattccgctagccgaacgactggaaggcctt
cctaaccatacgtatccaaatgataactatctcttggctgctttcaaagctcatggtgaa
cgcttaaatgcccaactaatggccatccttttgcagcatttaggttatgaagcacgtttt
gtgacaccaagtgaagctggtattattgttactggaactcccaataatgctaatgttatc
ccagaaacatatgcaaacttgagtcattttacgtttaatgaaaacgaattattaatattc
cccggtttctatggtctcacccttgccggacacattgctactttttcccgtggcggttct
gatatcaccggtgcgattcttgcgcgcggtcttcacgcctccacttatgaaaatttcacc
gatgttgatgctatttactcagccaatccacaaattgttgatcatccgcaaccaattaca
accatgacttaccgagaaatgcgggaactatcttacgctggtttttccgtctttcacgat
gaagcactgattcctgccattcaaggaaatattccaatcaatgttcgtaatactaatgac
cctgaaaagccaggaacaatgattgtccctgataaagattttcaaccaagcgacattgta
acgggggtcgtgagcggaaaacactttgcagccctctacctgcacaaatatctccttaac
aagcaagcaggttttactcttcggatccttgaaattctcgcaaagcacaacgtctcatac
gaacatatgccttcaggaatcgatgatataacaattatccttgatcggaatgcaattaat
gaccaattaatcgataccatctgcaatgaaattcaagaagagattaatcctgaccgttta
gaatggattgacaattatgcaattaccatggttgttggtgaaggtatgcgtaatcgcacg
ggggtaatcgatgatattttaatgcccctagctgaaaaacacattgcggttcccatgatt
aatcaaggagcttcacgaattgcaattatgattgggacatacaacgaagatgcagatgaa
gctgttcgagctatttaccatcgctttttcgcaaattag

DBGET integrated database retrieval system