KEGG   Lactobacillus reuteri DSM 20016: Lreu_0633Help
Entry
Lreu_0633         CDS       T00535                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lre01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lre00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lre00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lre00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
701353..702687
Genome map
AA seq 444 aa AA seqDB search
MAYIFRLPEMGEGLTEGDVASWLIKEGEAIKADDPLIEIQTDKSTTQLVSPVDGTVKKLF
VKEDDHVEKGDKLAEIDDGKPGISTNVESEDDDDETDTGSEEATESEESTAPAADSPSED
NSSKGRVAPLAEPNKLVMAMPSVRQYARDKGVDISLVQPSGNHGQVLKEDIDNFNGAAAP
AKEEKSAATSAKTAPVAAKTAGNTIKPWNADLEEREPMSNMRKIIAKTTRESKDISPHVT
SFDEVEVSALMASRKKYKAVAAEQDIHLTFLPYIVKALVATCKKFPELNASIDDSTQEIV
YKHYYNVGILTNTDHGLYNPNIKNADSKSMFEIAKEITENTQAAFDNKLSPESMAGRTIS
ISNIGSIGGGWFTPVINQPDVAILGVGRIDKEPYVNEDGEIVVGRMMKLSLTYDHRLIDG
GLAQHALNYMNKLLHDPELLMMEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcatacatttttagactaccagaaatgggagaaggattaactgaaggtgatgttgct
tcttggctcattaaagaaggagaagcaattaaagctgatgatcctttaattgaaattcaa
actgataaatcaactactcaattggtatctccagttgatggaactgtcaaaaaattattt
gtaaaagaagacgaccatgttgaaaaaggcgacaagctcgctgaaattgatgatggtaag
cctggtattagtacaaacgtcgaaagtgaagacgatgatgatgaaactgatacaggcagt
gaagaagctactgaaagtgaagaatccacggctccagctgcagattccccttcagaagat
aattcttcaaaaggtagagtagccccacttgcagaaccaaataagcttgtaatggcaatg
ccttctgttcgtcaatatgcccgtgataagggtgttgatatttcacttgttcaaccaagt
ggtaaccacggtcaagttcttaaagaggatattgataactttaatggggcagctgctcca
gctaaggaagaaaagagtgcggctacgtcagctaagactgctcctgttgcggctaagacc
gctggtaatacaatcaagccatggaatgctgaccttgaagaacgtgaaccaatgtctaat
atgcggaagattatcgctaagactactcgtgaatcaaaggatatctcaccacatgttaca
tcatttgatgaagttgaagtatctgctctaatggctagtcgcaagaagtacaaggcagtt
gctgcagaacaagatattcacttgactttcttgccatacattgttaaggccttagttgcc
acatgcaagaagttcccagaactaaatgcttcaattgatgattctactcaagaaattgtt
tacaagcactactacaatgttgggatccttacaaacactgaccacggtctctataatcca
aatattaagaatgcagattctaagagcatgtttgagattgcaaaagaaattactgaaaat
actcaggcagcctttgataacaagctaagtccagaatcaatggctggtcggactatcagt
atcagtaatattggttcaattggcggtggctggttcacccctgttatcaaccaaccagat
gttgctattcttggtgttggtcgaattgacaaggaaccatacgttaacgaagatggtgaa
attgttgttggtcgaatgatgaagttatcattgacttacgatcaccgtttaattgatggt
ggacttgcacaacatgcattgaactacatgaacaagttattacatgatccagaattattg
atgatggagggctag

DBGET integrated database retrieval system