KEGG   Lactobacillus reuteri DSM 20016: Lreu_0633Help
Entry
Lreu_0633         CDS       T00535                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00010  Glycolysis / Gluconeogenesis
lre00020  Citrate cycle (TCA cycle)
lre00620  Pyruvate metabolism
lre01100  Metabolic pathways
lre01110  Biosynthesis of secondary metabolites
lre01120  Microbial metabolism in diverse environments
lre01130  Biosynthesis of antibiotics
lre01200  Carbon metabolism
Module
lre_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lreu_0633
   00020 Citrate cycle (TCA cycle)
    Lreu_0633
   00620 Pyruvate metabolism
    Lreu_0633
Enzymes [BR:lre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lreu_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 PTS_EIIA_1 HlyD_D23 RnfC_N GCV_H DUF5481
Motif
Other DBs
NCBI-ProteinID: ABQ82898
JGI: Lreu0633
UniProt: A5VJ74
Position
701353..702687
Genome map
AA seq 444 aa AA seqDB search
MAYIFRLPEMGEGLTEGDVASWLIKEGEAIKADDPLIEIQTDKSTTQLVSPVDGTVKKLF
VKEDDHVEKGDKLAEIDDGKPGISTNVESEDDDDETDTGSEEATESEESTAPAADSPSED
NSSKGRVAPLAEPNKLVMAMPSVRQYARDKGVDISLVQPSGNHGQVLKEDIDNFNGAAAP
AKEEKSAATSAKTAPVAAKTAGNTIKPWNADLEEREPMSNMRKIIAKTTRESKDISPHVT
SFDEVEVSALMASRKKYKAVAAEQDIHLTFLPYIVKALVATCKKFPELNASIDDSTQEIV
YKHYYNVGILTNTDHGLYNPNIKNADSKSMFEIAKEITENTQAAFDNKLSPESMAGRTIS
ISNIGSIGGGWFTPVINQPDVAILGVGRIDKEPYVNEDGEIVVGRMMKLSLTYDHRLIDG
GLAQHALNYMNKLLHDPELLMMEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcatacatttttagactaccagaaatgggagaaggattaactgaaggtgatgttgct
tcttggctcattaaagaaggagaagcaattaaagctgatgatcctttaattgaaattcaa
actgataaatcaactactcaattggtatctccagttgatggaactgtcaaaaaattattt
gtaaaagaagacgaccatgttgaaaaaggcgacaagctcgctgaaattgatgatggtaag
cctggtattagtacaaacgtcgaaagtgaagacgatgatgatgaaactgatacaggcagt
gaagaagctactgaaagtgaagaatccacggctccagctgcagattccccttcagaagat
aattcttcaaaaggtagagtagccccacttgcagaaccaaataagcttgtaatggcaatg
ccttctgttcgtcaatatgcccgtgataagggtgttgatatttcacttgttcaaccaagt
ggtaaccacggtcaagttcttaaagaggatattgataactttaatggggcagctgctcca
gctaaggaagaaaagagtgcggctacgtcagctaagactgctcctgttgcggctaagacc
gctggtaatacaatcaagccatggaatgctgaccttgaagaacgtgaaccaatgtctaat
atgcggaagattatcgctaagactactcgtgaatcaaaggatatctcaccacatgttaca
tcatttgatgaagttgaagtatctgctctaatggctagtcgcaagaagtacaaggcagtt
gctgcagaacaagatattcacttgactttcttgccatacattgttaaggccttagttgcc
acatgcaagaagttcccagaactaaatgcttcaattgatgattctactcaagaaattgtt
tacaagcactactacaatgttgggatccttacaaacactgaccacggtctctataatcca
aatattaagaatgcagattctaagagcatgtttgagattgcaaaagaaattactgaaaat
actcaggcagcctttgataacaagctaagtccagaatcaatggctggtcggactatcagt
atcagtaatattggttcaattggcggtggctggttcacccctgttatcaaccaaccagat
gttgctattcttggtgttggtcgaattgacaaggaaccatacgttaacgaagatggtgaa
attgttgttggtcgaatgatgaagttatcattgacttacgatcaccgtttaattgatggt
ggacttgcacaacatgcattgaactacatgaacaagttattacatgatccagaattattg
atgatggagggctag

DBGET integrated database retrieval system