KEGG   Lactobacillus reuteri DSM 20016: Lreu_0910Help
Entry
Lreu_0910         CDS       T00535                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lre00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lre00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lre00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
964993..967182
Genome map
AA seq 729 aa AA seqDB search
MITFDEQQRVFHLKNKEISYLFSVEEGNILSHLYFGPAIRNYHGERRYPRVDRGFSGNLP
GSMDRTYSKDDLLQEYSGNNTGDYRVPAIIIKTENGSRLTDFRYKSYKILPGKPKLAGLP
ASYVKSDKEAETLEVILVDETIGAQLILSYTIYNERPVITRNARLVNTSNQELRIEKIAS
MQLDLTKHDYDVISVPGQYALERQPERQELRRGITEFSSRRNSSSHHMNPFVALVDKNTD
EFQGNALGVLLVYSGNHQFTLEKDQIDQIRLITGINDYDFEWVLEPGKDFQTPEAIMGFS
QQGLNGMSQVFHKLLRDRVARGKYQYADRPIVINNWEATFFDFDDKKLDQIIDEAKPLGI
EMFVLDDGWFGHRNDDNSSLGDWFVNQDKLTGGLKRVADRTHEHGMKFGLWFEPEMISVD
SKLYKEHPDYALHEPNRGMTLSRNQLVLDFSRKEVVDNIYNQMCLILDKVLLDYIKWDFN
RNLTEVFSSAADADHQGEISHRYVLGLYDLMERLVTRYPNILFEGCSGGGGRFDAGILYY
MPQSWPSDDTDAVERLKIQYGTSLTYPISSMTAHVSVSPNQQTGRSTSFKMRGDVAMSGV
FGYELDLADLTEEDRQMVKEQIKFYKAHRHLIQYGAFIRLESPFDSNTVAWEFVSPDKSE
ALLFMFKQLHTNRFEINNTKMAGLDPTIDYHDEMTDKTYGGDELMNVGLFRDPTHTGDFI
SEVHYFKGE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttgatgaacagcaacgtgtttttcacttaaaaaataaagaaatttcctat
ttattttcagtagaagagggaaatatcctcagtcacctttattttggaccggcaattcgc
aactaccatggtgaacgtcgatatccacgagttgatcgtggattttcagggaaccttcct
gggtcgatggaccgaacttactctaaagatgatttgttgcaggagtattcaggaaacaat
accggagactatcgcgtgcctgcgattattatcaaaacagaaaatggttcacgactgact
gatttccgttacaagtcttataagattttaccggggaagcccaaactagctgggttacct
gcatcttatgttaaaagtgataaagaagcagaaacgttggaagttattttggttgatgaa
acaattggtgcgcaacttattctttcgtacactatctataacgaacggccggttattaca
aggaatgcgcggttagtaaacacaagcaatcaagaattacgaattgaaaagattgcctca
atgcaactagatttaactaaacatgattatgacgttatctccgttccaggccagtatgcc
cttgaacgacaacctgaacggcaagaattacgtcggggaataacagaattttctagccgt
cgaaattctagttctcatcatatgaacccgtttgtggccttggttgataagaataccgat
gaatttcaaggaaacgctttgggagtgctccttgtttactctggtaatcaccagtttacc
ttggaaaaagatcagattgaccagattcgcttaataaccggaattaatgattatgacttt
gaatgggttcttgaaccgggaaaagattttcagacaccggaagcaatcatgggctttagt
cagcagggcctaaatgggatgtcacaagtattccacaagttattacgggaccgggttgct
cgcggtaagtatcaatatgcagaccgcccaattgttattaataattgggaagcgaccttc
tttgactttgatgataagaagttagaccaaattattgatgaagcaaagccattgggaatt
gaaatgtttgttcttgatgacggctggtttggccaccggaatgatgataattcatcgctt
ggtgattggtttgttaaccaggataagcttactggtggattaaagcgggtagcagaccgg
acccacgagcatggcatgaaattcggcctctggtttgagccagaaatgatttcagtcgat
tctaagttatataaggaacatccagactatgccttacatgaaccgaaccgtggcatgaca
ctttctcgtaatcaattagtactagactttagccgtaaagaagtcgttgataatatttac
aatcaaatgtgcttaattttagataaggtgctgcttgactatattaaatgggacttcaac
cgtaatcttactgaagtcttctctagcgcagcggatgcagaccatcaaggagaaattagc
caccgttatgttttaggtttatatgacttaatggagcggttagttacccgttatcctaat
attttgtttgaaggctgctctggcggtggtggccgctttgatgctggtattctttactac
atgccgcaaagttggccatcagatgatacagacgcggtcgaacggttaaagatccaatac
ggaacatctttaacttatccaatctcatctatgacggcgcatgtatcagtttcacctaac
cagcaaactggtcgttctactagttttaagatgcggggcgatgttgccatgagcggggtc
tttggctatgaacttgacttagcagatttgactgaagaggatcggcaaatggtaaaggaa
cagatcaagttctacaaggctcaccgccacttaattcaatatggtgcctttattcgctta
gaaagtccttttgatagcaatacagtcgcttgggaatttgtcagtcctgataagtcagaa
gcgctgctatttatgtttaagcagttgcatactaaccgttttgaaattaataataccaag
atggcgggacttgatccaacaattgattatcatgatgagatgaccgataagacttatggt
ggggatgaattgatgaatgtcggtttgttccgtgacccgactcatacgggggacttcatt
tccgaagtgcattactttaaaggtgaatag

DBGET integrated database retrieval system