KEGG   Lactobacillus reuteri DSM 20016: Lreu_1201Help
Entry
Lreu_1201         CDS       T00535                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lre00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1250971..1252476)
Genome map
AA seq 501 aa AA seqDB search
MDQKVRVRYAPSPTGFLHIGNAQSALFNYLFARHFDGTMVLRIEDTDTKRNVEDGEASQR
ENLHWLGIDWDEGPNKPNPKYAPYRQSERNKEGIYHKYIQELLDKGIAYKDYSTEEELAE
MRERQKANNEPPHYDGRWYGKSEEEQKAAEAKGLKPTIRFHFPKDHDYEWDDIARGHVSF
NSDNLGGDFIIEKSDGMPTYNFAVVVDDHTMDITHVLRGADHISNTPKQIAIYEALGWEH
PTFCHIPLIFNPKTRKKLSKRDKDTLQFISEYKKHGYLHEAIFNFIAFLGWSPVGEREIY
SKEELIKVYDPKRMSKAPAYFDQKKLDWMNAQYIKSMSIDELTDRTMELIKEGETEEAKR
LQSIPEEQLTELLKKTIKVHQRDVNKLLEVIQYAWSYYTVLDQSFNYDLLKDNEDFANED
VLAVLKGLKAKLENGDDDLDYSQAIKEVGKDTGIKGRGLYFPLNLAFTGSTSAPQIYEIM
DIYSRDTDIELLDRMIKAFEN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaggtcagagttcggtatgcacctagcccaacaggtttcttacatatcgga
aatgctcaatcagcattatttaattatttatttgcacgtcacttcgatggaacgatggta
ttacggattgaagataccgacaccaaacggaacgttgaagatggtgaagctagccaacgt
gaaaatcttcactggttaggaattgactgggatgaaggtccaaataagccaaatccaaag
tatgccccttaccgtcaaagtgaacggaataaagaaggtatttaccacaaatacattcaa
gaattgttagacaaggggattgcatacaaggattactcaacagaggaagagttagccgag
atgcgtgaacggcaaaaggctaacaatgaaccacctcattatgatggtcgttggtatggt
aagagtgaagaagaacaaaaggcggctgaagcaaagggcttgaagccaactattcgtttc
cacttccctaaagaccatgattacgaatgggacgatattgcacgtggtcatgtttcattt
aactctgacaaccttggtggtgacttcatcattgaaaagagtgatggaatgccaacgtac
aattttgccgtcgtagttgatgaccacactatggacattacccatgttttgcgtggtgct
gatcacatttcaaacacaccaaagcaaattgctatctatgaagcattaggctgggaacac
ccaactttctgtcacattccattgatctttaatccaaagactcgcaagaagttaagtaag
cgtgataaggatacccttcaattcattagtgaatacaagaagcacggttacctccacgaa
gcaatctttaactttatcgcattcttaggctggtctccagttggtgaacgtgaaatttac
tctaaagaagagttgattaaggtttacgatccaaagcggatgtcaaaggcaccagcctac
ttcgatcaaaagaaacttgattggatgaatgctcaatacattaagagtatgtcgattgat
gaattaactgatcggacaatggaattaattaaagaaggcgaaaccgaagaagctaagcgc
cttcaaagtattccagaagaacaattgactgaattgcttaagaagacaattaaggttcac
cagcgggatgttaataagcttcttgaagttattcaatatgcatggtcatactatacagtt
cttgaccaatcattcaactatgacttgcttaaggacaacgaagacttcgctaatgaagat
gttttagctgttctcaagggcttaaaggcaaaacttgaaaacggtgacgatgacctggat
tacagtcaagctattaaggaagtaggtaaggacactggcattaagggtcgcggtttatac
ttcccattaaaccttgcctttactggttcaacgtctgcaccacaaatttatgagatcatg
gatatctattctcgtgatacagatattgaattgcttgaccggatgatcaaagcatttgaa
aactaa

DBGET integrated database retrieval system