KEGG   Lactobacillus reuteri DSM 20016: Lreu_1246Help
Entry
Lreu_1246         CDS       T00535                                 

Definition
(GenBank) DNA-(apurinic or apyrimidinic site) lyase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lre00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Lreu_1246
Enzymes [BR:lre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Lreu_1246
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Lreu_1246
DNA repair and recombination proteins [BR:lre03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Lreu_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA Auto_anti-p27 TF_Zn_Ribbon OrfB_Zn_ribbon zf-ribbon_3 DZR Clavanin Zn_Tnp_IS91 zf-TFIIB Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ABQ83503
JGI: Lreu1246
UniProt: A5VKX9
Position
complement(1290980..1291810)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVETVRRGLLKIAAKRKINAIDVYYGKTITNDVEDFRQALIGQTIENIDRRGKYL
LFRFTNDLTMISHLRMEGRYYNQPIGGPIDKHTHVVFEFTDGTELCYQDTRKFGRMTLVK
TGDEMNVGGLKTIGPEPTEDAFTLPYFTTELKKSRGKIKPFLLNQRHVAGLGNIYVDEVL
WMTGINPEQPANTLTANQIAELRENIIKELATAIKYKGTTVHSFTNAFGDAGAFQDRLKA
YGHAGDECPRCGTKMVKIKVAERGTTFCPHCQVLKE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaagttgaaactgttcgccgcggtttgctgaagattgccgctaag
cgtaaaattaacgcgatcgatgtttattatggtaaaacgattaccaatgacgttgaagat
tttcggcaggcgttgattggccagacgattgaaaatattgatcggcgaggaaaatatctt
ctttttcgtttcactaatgatttgacgatgatttcacatcttcgtatggaaggaagatat
tacaaccaaccgattggcggaccaattgataaacatacccatgttgtctttgaatttaca
gatggtacggaattatgttaccaagacacccgtaaatttggtcggatgacattggtaaaa
accggtgatgagatgaatgtcggtggattgaagacgattggccctgaaccgacagaagac
gcctttaccttgccatactttacaactgaattaaaaaagagtcggggaaagattaagcca
ttcttgctcaatcagcgtcatgtcgccggtctgggtaacatttacgttgatgaggtacta
tggatgacggggataaatccggagcaaccagccaatactttaacagctaaccagattgct
gaattacgggaaaatatcatcaaagaattggcgacagcgattaagtacaagggaaccact
gtgcatagttttacgaatgcatttggtgatgctggtgcttttcaagatcgcttaaaagct
tatggtcatgcgggggatgaatgtccgcgttgtggcacaaaaatggttaaaattaaggtt
gctgaacgcggaacgaccttttgtccccactgtcaagtattgaaggaatag

DBGET integrated database retrieval system