KEGG   Lactobacillus reuteri DSM 20016: Lreu_1275Help
Entry
Lreu_1275         CDS       T00535                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lreu_1275
Enzymes [BR:lre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Lreu_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1324546..1325709)
Genome map
AA seq 387 aa AA seqDB search
MKVTENLVTKDHSKLVSAILADQVNRHQQLLLTWECSDVETAGMVEQFIRHFDSPVACVE
KRVEFSFPLLSLKELIAQVKEQWENDQELIASLEQVYHRHQIIWRAGRFTFDLTEQPVIY
GILNVTPDSFYDGGKFQSHSAIASQIAKMVAAGANVIEVGGQTTKPGGFKEVDPEEEIAR
IMPAIQLLRENYPQIAIAVDTYKLPVMAAAIKAGVDIINDVQAFNSKQKLILMAKANVGM
VTMHSSRTHDYDNLTVAMQKFFEHNLGTIAAAGIDLERVILDQGIGYAKVADGYQDYAMM
RNIDQLNYLQRPIMVAISRKGFGQKLFNLAKEDRLGVTLIAETAMYLRGGRVLRVHDVEE
TSQLVKMIDTIENSYWFRSTSSQSQRQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttactgaaaatttagttactaaagaccattcgaagttagtgtccgcgatctta
gccgaccaagttaatcgtcatcagcagcttttattgacgtgggagtgttcagatgtggag
acggctggaatggtagagcaatttatccgtcattttgatagccccgtcgcttgtgttgaa
aagcgtgtagaattttctttcccgctcctttccctaaaagaactaatagcgcaggtgaaa
gagcagtgggagaacgaccaagaattaattgcttctcttgagcaggtttaccatcgtcac
cagattatttggcgtgcaggccggtttacttttgatctgacagagcaaccggtgatttat
ggaattttaaatgtaactcctgactcattttatgatgggggtaaatttcaatcccactcc
gctattgctagtcaaattgctaagatggtggcagctggggcaaacgtaattgaagtcggt
gggcaaactacgaaaccgggtggctttaaagaggttgatccggaagaagaaattgcgcga
attatgccggctattcagcttcttcgtgaaaactatccccagattgcgatcgcagttgat
acgtataaactcccagtaatggcagcggcaattaaggccggagtagatattatcaatgat
gtgcaggcatttaattcaaaacaaaaactaattttgatggctaaggcaaatgttggaatg
gtaacgatgcatagcagccgaacccatgactatgataaccttaccgtcgcgatgcagaaa
ttctttgaacacaatcttgggacaatagcagctgctggtattgatcttgaacgagtgatt
ttagaccaaggaattgggtatgcaaaggttgcggatggttaccaagattatgcgatgatg
cgcaacattgaccagcttaattacctccagcgcccgattatggttgcgatatcccgaaaa
ggttttggtcaaaaattatttaatctagcaaaagaagaccgtctcggcgtaacattgatt
gctgagacagcaatgtatttgcgaggcggtcgtgttttacgagttcatgatgtcgaggaa
actagtcagttagtgaaaatgattgacactattgaaaacagttattggtttagatccacc
agcagccaatcccaaaggcaataa

DBGET integrated database retrieval system