KEGG   Lactobacillus reuteri DSM 20016: Lreu_1395Help
Entry
Lreu_1395         CDS       T00535                                 

Definition
glutamate--cysteine ligase (EC:6.3.2.2)
Orthology
K01919  
glutamate--cysteine ligase [EC:6.3.2.2]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Lreu_1395
Enzymes [BR:lre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     Lreu_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1453523..1455052)
Genome map
AA seq 509 aa AA seqDB search
MGTDYDQLKAALKEPSLNAKLFSSQFGLEAKKHRILTNGRASRYPYPENLRSRQYNIYLN
SGYTDDMMDFETGPVVGAKNAVRQLKMLEQIVISHLRSDERLWPLSMAPGPTYQHDLEYL
QTAFTKKWDQETHDYLGKKYGIVQEILGDVHVNFSLDGELINEIYHRFYADRYPNRIDFQ
NHLYFKLAQKFYLYQWLFTYLYGASPVSEDMPHSIPEDLELPVRSLRCSDYGDDNFTNEQ
VTYTSYDQHFAELKHFMDNGTYYSMKEFFGPVRLRRHNHDMHDIDGALHKGIDYLEFRNF
DLDPLSRTGISDDTINFLELMLLNSILSPLPDNLEERLAEAKKRNNEVALQKPKEQLPWM
HEEAMQLIAELQNFIVEFNAPREYQLALKFVQRRVDDPSLTLSGQLADQLENGDLLSFGL
KIANDRYTKNINFQHPLQAISDVYSDDVQQLVKAAIELGVQIDLQPTQVVLYVGDHQESY
NAQATFDFSKGARDVILSDFPEVQDFQEK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgattatgatcaacttaaagcagctttaaaagaaccgtcattaaatgccaaa
cttttttcttcacagtttggtttagaggcaaagaagcaccgaattttgaccaatgggcgg
gcaagtcgttatccatatcctgaaaatctgcgttcgcggcaatataatatttatttgaac
tcaggctatacggatgacatgatggactttgaaacgggtccagttgttggagctaaaaat
gcagttcggcaactaaaaatgttagagcagattgttatctcacatttacggagtgatgaa
cgattatggccgttaagtatggcgccaggaccgacttatcagcatgaccttgaatattta
caaactgcatttactaagaaatgggaccaagagactcatgattacctaggaaagaaatat
ggtattgttcaagaaattttaggggatgtccatgttaattttagtttggatggtgaatta
atcaacgagatttatcaccgcttttatgcagaccggtatccaaaccgcattgattttcaa
aatcatctttactttaaattagcgcaaaaattctacctttatcaatggttatttacgtac
ttatatggagcaagtccggtttctgaagatatgccacatagtattccagaggatttggag
ctgccagttcgaagtttgcgttgtagtgattatggggatgataactttaccaatgagcaa
gttacctatacttcatacgaccagcattttgcagaactaaagcacttcatggacaatggc
acttactatagtatgaaggaattctttggcccagtacgattacggcggcataaccatgat
atgcatgatattgatggggctttacataaaggaattgattatcttgaatttcgtaatttt
gaccttgacccgttgtcgcgaacaggaattagtgatgatacgattaacttccttgaatta
atgcttttaaatagtattctttcaccattacctgataacttggaggaacgattagcggaa
gcaaaaaagcggaataatgaagtggccttacaaaagccaaaggaacaattgccgtggatg
catgaagaagcaatgcagttaatcgcagagttgcaaaactttattgttgagtttaatgct
ccgcgagaataccagcttgctttgaagtttgtacaacgacgagtggatgatccttcacta
actcttagcggtcagttagcagatcaacttgaaaatggtgatttattatcatttgggtta
aaaattgccaatgatcgttacacgaaaaatattaatttccaacatccattgcaagcaatc
agcgatgtttactcagacgatgttcaacaattggttaaagctgccattgagttaggtgtc
caaatagacttgcaaccaacgcaagtagtattatatgtaggagatcatcaagaaagttat
aatgctcaagcaacttttgatttctcaaagggtgcccgtgatgtaattcttagtgatttc
ccagaagttcaggattttcaggaaaaataa

DBGET integrated database retrieval system