KEGG   Lactobacillus reuteri DSM 20016: Lreu_1496Help
Entry
Lreu_1496         CDS       T00535                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Lreu_1496
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lreu_1496
  Lipid metabolism
   00071 Fatty acid degradation
    Lreu_1496
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lreu_1496
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lreu_1496
   00626 Naphthalene degradation
    Lreu_1496
Enzymes [BR:lre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lreu_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1548840..1549868)
Genome map
AA seq 342 aa AA seqDB search
MKAAVINDPVDGFVTVKDVQLRDLKPGEALVDMEYCGLCHTDLHVAAGDFGKKPGRIIGH
EGVGRVSKVAPGVTSLKVGDRVSIAWFFKGCGHCEYCLTGRETLCRNVLNAGYTADGAMA
EQCIVPADYAVKVPEGLDPVEATSLTCAGVTMYKALKVADIKPGQWVSIVGAGGLGNLGI
QLAHNVFGAHVIAVDGNPDKLEAAKKNGAEILINRHDGDVDKQIQEKVGGVHAAVVTAVS
ASAFDQAVDSLRPDGKLVAVALPQGDMKLNIAKTVLDGIIVAGSLVGTRQDLAECFQFGA
EGKVHPIVKTRKLSEINDMIQELKDNKVVGRNVVDFVHNDND
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttattaatgatccagtagacggttttgttactgttaaagatgttcaa
cttcgggatttgaagcccggtgaagctttagttgacatggaatattgtggtctttgtcac
actgatctacacgttgctgctggggactttggtaagaagcccggtcgtattatcggtcac
gaaggggttggtcgtgtatctaaggttgcccctggcgttacttccttgaaagttggcgac
cgtgtatcaattgcatggttcttcaagggctgtggacactgtgaatattgtttaactggt
cgtgaaactctttgtcggaacgttcttaatgcgggttacactgctgacggtgcaatggct
gaacaatgtatcgtaccagctgactacgctgttaaggttccagaaggtcttgatcctgtt
gaagctacttcattaacttgtgctggtgttacgatgtacaaggcattaaaggttgctgac
atcaagccaggtcaatgggtatcaatcgttggtgctggtggtttaggtaacttgggtatt
caacttgctcacaacgtatttggtgctcatgttatcgctgttgatggtaatcctgataag
cttgaagccgctaagaagaatggtgctgaaattttaattaaccgtcatgacggtgatgtt
gataagcaaattcaagaaaaggttggcggtgttcacgctgctgtagtaacagctgtttct
gcctctgcattcgaccaagcagttgattcacttcgcccagatggtaagcttgttgccgtt
gcgcttccacaaggtgacatgaagcttaacattgctaagactgttcttgatggtatcatt
gttgctggttcattagttggtacccgtcaagacttagctgaatgtttccaatttggtgca
gaaggtaaggttcacccaattgttaagactcgtaagttaagcgaaattaatgatatgatc
caagaacttaaggataacaaggttgttggtcggaatgttgttgattttgttcacaacgat
aacgactaa

DBGET integrated database retrieval system