KEGG   Lactobacillus reuteri DSM 20016: Lreu_1701Help
Entry
Lreu_1701         CDS       T00535                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lreu_1701
Enzymes [BR:lre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Lreu_1701
Exosome [BR:lre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lreu_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1762780..1763751)
Genome map
AA seq 323 aa AA seqDB search
MLQFDRHRRLRTSTAMRDLVRETHLNKDDLIMPVFVDATINGREEIPSMPGIYRYSLDSI
LDEITEIVKLGIKSIIIFGVPERKDEVGTGAWEDNGIVQQAIRLIKKNYPDLIVIADTCL
CEYTSTGHCGILKDGVVLNDESLKYLTKTAVSQVKAGADIIAPSNAMDGYVAAIRQGLDE
AGYKNTPIMSYAVKFASSFYGPFRDAADGSPKEGPKDRKTYQMDPANRLEALREVASDEK
EGADFVMVKPAMAFLDIMREVRNHTLLPLVAYNVSGEYAMIKAAAANGWINENQIVYESL
VGMKRAGADLIITYFAKDVAKKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaatttgatcgtcatcgtcgtttacgtactagcactgccatgcgtgatttagta
agagagactcatctcaataaggatgatctaattatgccggtctttgtggatgccactatt
aatgggcgagaagaaattccatcaatgccaggcatttaccgttacagtttagattcaatt
cttgatgaaattacagaaattgtgaagttaggaattaaatcaattattattttcggtgtt
ccagaaagaaaagatgaagttggaactggcgcatgggaagataatggaattgttcaacag
gcaattcgtttgattaagaaaaattatccagatttaattgttatcgctgatacttgttta
tgtgaatatacaagtactggtcactgtggaattcttaaagatggggtcgttttgaatgat
gaatcattaaaatacttaacaaagacagctgtaagtcaagtaaaagctggagctgacata
attgcaccgtctaatgcgatggatgggtatgttgcagcaattcgccaaggacttgatgaa
gcagggtataaaaatacaccgattatgtcctatgctgtgaaatttgcctcatcattttac
ggcccattccgtgatgctgctgatggttcgcctaaagaagggcctaaagatcgtaaaaca
tatcaaatggatccagctaatcgcttagaagcattgcgcgaagtagctagtgatgaaaag
gaaggtgctgattttgtgatggttaaaccagcaatggccttcttggatattatgcgtgaa
gttcgtaatcatactttgctgccgttagttgcatataatgtttctggtgaatatgcaatg
attaaagcagctgcggctaatggttggattaatgaaaaccaaattgtttacgaaagtctg
gttggaatgaaacgagctggagcagacttaattattacttactttgccaaggacgttgct
aagaaactttaa

DBGET integrated database retrieval system